KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325905
Entry
4325905           CDS       T01015                                 
Name
(RefSeq) ubiquitin-conjugating enzyme E2 36
  KO
K10580  ubiquitin-conjugating enzyme E2 N [EC:2.3.2.23]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4325905
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4325905
   03400 DNA repair and recombination proteins [BR:osa03400]
    4325905
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     4325905
Ubiquitin system [BR:osa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   4325905
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Rad6 epistasis group
    4325905
SSDB
Motif
Pfam: UQ_con UEV RWD
Other DBs
NCBI-GeneID: 4325905
NCBI-ProteinID: XP_015621872
UniProt: Q8W0I1 A0A8J8XXJ7
LinkDB
Position
1:complement(27668577..27671643)
AA seq 153 aa
MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMILGPAQSPYEGGVFKLELFL
PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
DPLSDNIAKHWKANEAEAVETAKEWTRLYASGA
NT seq 462 nt   +upstreamnt  +downstreamnt
atggccaacagcaacctcccccggcgaatcatcaaggagacgcagcgactcctcagcgag
ccagcgccgggaatcagcgcgtctccgtcggaggagaacatgcgctacttcaacgtcatg
atccttggcccggcacagtccccctatgaaggtggagtttttaagcttgaactcttttta
cctgaggaatatcctatggctgctccaaaggttaggttcctgaccaaaatataccacccc
aacattgacaagcttggtaggatatgccttgacattctcaaggacaaatggagcccagcc
cttcagattcggacagttcttttgagtatccaggcactcctaagtgcaccaaaccctgat
gatcctctctctgataacattgcaaagcactggaaagccaatgaagcagaagctgttgaa
acagcaaaggagtggactcgcctgtatgccagcggtgcataa

DBGET integrated database retrieval system