KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336980
Entry
4336980           CDS       T01015                                 
Name
(RefSeq) peroxisomal 2,4-dienoyl-CoA reductase
  KO
K13237  2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing], peroxisomal [EC:1.3.1.124]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4336980
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.124  2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing]
     4336980
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Pyr_redox Pyr_redox_2 Glyco_tran_WecG 3HCDH_N Sacchrp_dh_NADP ApbA
Other DBs
NCBI-GeneID: 4336980
NCBI-ProteinID: XP_015635702
UniProt: A0A0N7KJP4 Q7XLC5
LinkDB
Position
4
AA seq 299 aa
MAVESPFRADVLRGKAALVTGGGSGIGFEIAAQLARHGAHVAIMGRRREVLDKAVAALRS
HGLRAVGFEGDVRKQEDAARVVAATVQHFGKLDILVNGAAGNFLASPEDLTPKGFRTVVD
IDTVGTYTMCYEALKYLKKGGPGKGPSTGGVIINISATLHYTAAWYQIHVSAAKAGVDSI
TRSLALEWGTDYDIRVNGIAPGPIEGTPGMRKLAPEEMAKGSREIMPLFKLGEKWDIAMA
ALYLASDAGKYVNGTTVVVDGGLWLSRPRHIPKEEVKELSKVVEKKVRASGVGVPSSKL
NT seq 900 nt   +upstreamnt  +downstreamnt
atggccgtggagtcgccattcagggcggatgtgttgaggggcaaggcggcgctggtcacc
ggcggcggctccggcatcgggttcgagatcgccgcccagctcgcccgccacggcgcgcac
gtcgccatcatgggccgccgccgcgaggtcctcgacaaggccgtcgccgccctccgctcc
cacggcctccgggctgttggttttgagggagatgtgcgcaagcaggaagatgccgcgaga
gtggttgccgcaacagttcaacattttggtaagctagacattcttgtcaatggggcagct
ggcaatttccttgcttccccggaggatttgacgcccaaagggttcaggacagtcgttgac
attgacacagtgggtacatacactatgtgctatgaagctctaaagtatctgaaaaagggt
ggccctgggaaaggtccctctactggtggcgtcatcatcaacataagtgctactttgcat
tacactgcggcctggtaccaaattcatgtctctgctgctaaggcgggcgttgatagtata
acaagatcattggctctggaatggggaacagattatgacatcagggtcaatggaattgca
ccagggccaattgaaggcactccaggaatgaggaagcttgcacctgaggaaatggccaag
gggagtcgggaaataatgcctttatttaagttgggtgaaaaatgggacatagctatggct
gcactttaccttgcttctgatgcaggaaaatatgtaaatgggactacagtggttgttgat
ggaggtctttggctaagtcgccctcgccatattccgaaggaggaagtgaaggagctctca
aaggttgtcgagaagaaggttagggcctctggtgttggtgtgccatcaagcaaattgtga

DBGET integrated database retrieval system