KEGG   Purpureocillium lilacinum: VFPFJ_05955
Entry
VFPFJ_05955       CDS       T05029                                 
Name
(RefSeq) cytochrome p450 55a3
  KO
K15877  fungal nitric oxide reductase [EC:1.7.1.14]
Organism
plj  Purpureocillium lilacinum
Pathway
plj00910  Nitrogen metabolism
plj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plj00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    VFPFJ_05955
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:plj00199]
    VFPFJ_05955
Enzymes [BR:plj01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.14  nitric oxide reductase [NAD(P)+, nitrous oxide-forming]
     VFPFJ_05955
Cytochrome P450 [BR:plj00199]
 Cytochrome P450, fungi type
  CYP55 family
   VFPFJ_05955
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 28888079
NCBI-ProteinID: XP_018178260
UniProt: A0A179HIX8
LinkDB
Position
Unknown
AA seq 405 aa
MTVPEPPKFPFLRASGLEPPAEFARLRATDPLSQVRLFDGSLAWLATKYEDVCFVATDDR
LSKVRARPGFPELSAGGKEAAKAKATFVDMDAPDHMHQRGMVEKFFDTTYVNNLRPYIQK
TVDDLLDAIVAKGCHSGPIDLIKEFALPVPSYVIYHILGVPPHDLEKLTHKNAIRSNGSA
TAREASAASQELLDYLSALVDDRAREPKNDLISSLVTEQVKPGHIEKSDAVQIAFLLLVA
GNATMVNMIALGVVTLFQNPSQLEQLKKDPSLASTFVKELTRFHTGSALAMKRTAKVDVQ
LRGKLIKAGEGIIASNQSANRDEDVFANPDTFDMNRKWPADKDPLGYGFGDHRCIAELLA
NTELTTVFATLFQKLPGLTLTQRPEDVQCTPLHKDVGIVELPVTF
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgactgttcccgagccccccaagtttcccttccttcgagcatcaggcctcgagccaccg
gccgagttcgctcgccttcgggcgaccgatccgctgtcccaagttcgacttttcgacggg
agcctggcgtggcttgcaacaaagtacgaagatgtctgctttgtggccaccgatgaccgc
ctgtccaaggtccgagcacgaccggggttccccgagctcagtgcaggcggcaaggaagct
gccaaggcgaaagcaacttttgtcgacatggacgctccagaccatatgcaccagaggggc
atggttgagaaattcttcgacacaacttatgtcaacaacctgcgaccatatatccagaag
acagtagatgaccttctggacgccatcgtggccaagggatgccacagtggccctatcgat
ctgatcaaggaatttgcacttcctgttccgtcatatgtcatctaccacatccttggagtc
ccgcctcacgacctggagaagttgacacacaagaacgccatccgctcaaacggaagcgcc
acagcccgagaggcatcggcggctagccaagagctgctagactacctcagtgctttggtc
gatgatcgcgccagagaaccgaagaatgacctcatcagcagccttgtcacggagcaagtg
aagcccggccacattgagaagtccgacgctgttcaaattgcgttcctgctcctcgttgcg
ggaaatgctaccatggtgaacatgatcgctcttggcgttgtcacgctgttccaaaatcca
tcgcagcttgagcagctgaagaaggacccatcgcttgcttctactttcgtcaaggagctc
actcgatttcacacggggtccgctctggccatgaagcgcactgctaaagtcgacgtgcaa
ctgcgtggaaagctcatcaaagccggcgagggcatcatcgcgtccaaccagtccgccaat
cgagatgaggatgtctttgcgaaccctgacacctttgacatgaaccgaaagtggcctgcc
gataaggatccgctcggctacggctttggcgaccatcgctgcattgccgagctgctggcg
aatacagaactcacgacggtctttgctactctattccagaagttgccaggcctgacactt
actcagcgccccgaagacgtgcagtgcacacctctgcacaaggatgtcggcattgtcgag
ctccctgtgacgttctaa

DBGET integrated database retrieval system