KEGG   Sordaria macrospora: SMAC_06378
Entry
SMAC_06378        CDS       T01610                                 
Name
(RefSeq) uncharacterized protein
  KO
K15877  fungal nitric oxide reductase [EC:1.7.1.14]
Organism
smp  Sordaria macrospora
Pathway
smp00910  Nitrogen metabolism
smp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smp00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    SMAC_06378
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:smp00199]
    SMAC_06378
Enzymes [BR:smp01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.14  nitric oxide reductase [NAD(P)+, nitrous oxide-forming]
     SMAC_06378
Cytochrome P450 [BR:smp00199]
 Cytochrome P450, fungi type
  CYP55 family
   SMAC_06378
SSDB
Motif
Pfam: p450 DUF6576
Other DBs
NCBI-GeneID: 10802033
NCBI-ProteinID: XP_003344723
LinkDB
Position
Unknown
AA seq 428 aa
MSFVLARTQPLTSRLFTSPSRRTQVSLHRTASAFFSTTTKMGALTENLEFPFRRASGLDP
PPGVRPLAWMVTKYHDVCQVATDERLSKERTRPGFPELSAGGKEAAKNRATFVDMDPPKH
MQYRGMVQPIFNIEHIQELKPYIQKTVDDLLEKMKSKGCEGGPVDLVQNFALPVPSYIIY
TILGVPFEDLEFLTQQNSIRTNGSSTAREASAANQELLGYLRRLAEDRLKEPKDDLISKL
MTEQVKTGKLDVPDAVQMAFLLLVAGNATMVNMIALGIVTLFQNPSQLEELKRDPSVIPG
FVEELSRFHTASAMAIRRVAKEDLEIGGRTIKKGEGVIASNLSANRDEEVFKDADKFDMH
REWPERELGFGWGEHRCIAEFLAKAEMRAVFGTIFKKLPNLKIAVPMDKIEYTPLDRDVG
IVKLPVTW
NT seq 1287 nt   +upstreamnt  +downstreamnt
atgtccttcgtcctagctcgcactcaacctttaacctcgaggcttttcacatcgccgagt
cgtcgcactcaagtttcccttcaccgaacagcttcagctttcttctcaacaaccaccaaa
atgggcgccctcaccgaaaacctcgagttccccttccgccgcgcctccggcctcgaccct
ccccccggagttcgccccctcgcctggatggtgaccaagtaccacgacgtctgccaggtg
gccacggatgagcggctgtccaaggagcgcacacggcccggcttccccgagctaagcgcg
ggcggaaaggaggcggccaagaaccgggccacgttcgtggacatggatccgcccaagcac
atgcagtatcgtggcatggttcagcccatcttcaacattgagcatatccaggagctgaag
ccttacatccagaagacggtggatgacttgctggagaagatgaagagtaagggatgtgag
ggggggccggtggatttggtgcagaattttgcgttgccggtgccttcttatatcatctat
accatccttggcgtcccgtttgaggacctcgagtttttgacccagcagaactcaatccgt
acgaacggaagttcaacagcgcgtgaggcgtctgctgctaatcaggagctcctcggctac
ctccgccgcctagctgaggatcgtctgaaggaacccaaggacgacttgatcagcaaactc
atgacggagcaagtcaagaccggcaaactcgacgtccccgatgccgtccagatggctttt
ctcttgctagtggccggcaatgccaccatggtgaacatgattgccttgggcatcgtaacc
ctctttcagaacccctcccaactcgaagaactcaagcgcgacccctccgtcatccccggc
ttcgtcgaagagctcagccggttccacacggcttcggccatggccatccgccgcgtcgcc
aaggaggacctcgagatcggcggcaggaccatcaagaagggtgagggcgtcattgcctcc
aacttgtcggccaaccgcgacgaggaggtcttcaaggacgcggacaagttcgatatgcat
cgcgaatggcctgagagggagctgggctttgggtggggagaacataggtgtatcgcggag
tttttggccaaggcggagatgagggctgtctttggaaccatcttcaagaagttgccgaat
ctcaagattgcggtacccatggacaagatcgagtacacgcctctcgatcgcgatgttgga
atcgttaagttgcctgtcacatggtaa

DBGET integrated database retrieval system