KEGG   Talaromyces marneffei: PMAA_015700
Entry
PMAA_015700       CDS       T06392                                 

Definition
(RefSeq) FAD binding domain protein
  KO
K23668  fumiquinazoline A oxidase [EC:1.5.3.-]
Organism
tmf  Talaromyces marneffei
Pathway
tmf01100  Metabolic pathways
tmf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tmf00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    PMAA_015700
Enzymes [BR:tmf01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.-  
     PMAA_015700
SSDB
Motif
Pfam: FAD_binding_4 BBE
Other DBs
NCBI-GeneID: 7021030
NCBI-ProteinID: XP_002143163
UniProt: B6Q7A6
LinkDB
Position
Unknown
AA seq 486 aa
MTRFSIPSILALPLLAAAQSYNLTALFAPVLSPTAEIYYANDSNWTQEVTQRWSTWDAPT
YLGAIKPVTERDVQNIVKVASARNISFLATGGGHGVSQGFAKVQNAIDIDLSNFKTVDLD
VENNRVTVGGGATYGQLYDPLYNAGKEIPTGNAPCVGVVGATVGAGVGLLQGLHGYTSDA
LISARIVTASGVLFEASATNNTELFWAIRGAGANFGIITSATYKVYDATNAGQAQNADFL
YPEISNRTVWGTLQTLDETLPAELSVTITSAYNQTSGQAAIIVNLVYFGAYDDFRPYVDQ
FVAINPTQWRNVTAPWNELVEAANFGAPSHGCGTDSHINFFSIALNQTDPLTFQGFFDDL
ILFSQQNPSYNGAWVIERYGTQGPLAIPEESRGVYPWREAKIQLLWESSYPDSSLDDTVR
AFYTQQRQHFNEFSGFPTFAAYVNYAHGDEGPNVWYGDADNLSRLSAAKRKWDSNNLFGA
AKPVPL
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgacgaggttcagcataccgtctatattggcattgccccttctggcagcggcacagagt
tacaacctcaccgcgctctttgctcccgtcctgtctcctacagctgagatatattatgcc
aacgatagtaattggacacaagaggtcacccaaagatggagcacctgggatgctcctaca
taccttggtgccatcaagccagtcactgagcgggatgtccagaacatagtcaaagtcgcg
tctgcgcgtaatatctcgtttcttgccactggcggtggtcacggcgtgtctcagggtttt
gcgaaggtacaaaatgccattgacattgacttaagcaatttcaagacggttgatcttgat
gtggagaacaatcgagtcactgttggtggcggcgcaacttatggtcaactgtatgatcct
ctgtataatgccggaaaggagatccccacgggtaatgcaccatgcgtaggcgtggttgga
gccactgttggtgccggtgtgggtttacttcaggggttgcatggctatacctccgatgct
ttgatttcagcacgaatcgtgactgcatctggcgtactgtttgaggcgtcggcaacgaac
aataccgaacttttctgggctattcgtggcgctggtgcaaattttggtatcatcacctcc
gcaacttacaaggtttatgatgcaacaaatgctggacaggcacagaatgcggattttctc
tatcccgagatttcaaatcgaacagtttggggcactcttcaaactttggatgaaacgctt
ccagctgagttgtcagtcacaatcacttctgcgtacaaccagacgtccggacaggctgcc
atcattgtaaatctcgtttatttcggggcatatgatgacttccggccatatgttgaccaa
ttcgttgcgatcaacccaacacaatggcgaaatgtcacggccccctggaatgagttggta
gaggcagcaaattttggggcaccatcacatggttgcgggacagattcacacatcaatttc
ttcagcattgccttaaatcaaactgatcctttgacattccaagggtttttcgatgacctt
attcttttctctcaacaaaatccctcgtacaacggagcctgggtcattgaacgttatggc
acacaagggccattggcgatccctgaagagagccgaggcgtttatccctggcgcgaggca
aaaatacaacttctttgggaaagcagttaccccgactcctctctagatgataccgtgcgc
gccttctacacccaacaacgccaacactttaacgaattcagcggtttcccaacttttgct
gcgtacgtcaactatgcccatggcgacgagggtccaaatgtctggtatggtgacgcagat
aatctctcccgtttgagcgcagccaaacgaaaatgggattcaaacaatcttttcggagca
gcaaagcctgtgcccttgtga

DBGET integrated database retrieval system