KEGG   Acidovorax avenae: Acav_2020Help
Entry
Acav_2020         CDS       T01445                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
aaa  Acidovorax avenae
Pathway
aaa00010  Glycolysis / Gluconeogenesis
aaa00620  Pyruvate metabolism
aaa01100  Metabolic pathways
aaa01110  Biosynthesis of secondary metabolites
aaa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acav_2020
   00620 Pyruvate metabolism
    Acav_2020
Enzymes [BR:aaa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Acav_2020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA LuxC
Motif
Other DBs
NCBI-ProteinID: ADX45934
JGI: Acav_2020
UniProt: F0Q903
LinkDB All DBs
Position
complement(2256841..2258361)
Genome map
AA seq 506 aa AA seqDB search
MDMAEIANLGIANPYKKQYGNYIGGQWVPPVDGQYFENSSPINGQVFTSVPRSNDKDVNA
ALDAAHKAKAAWGKTSTTDRANILLKIADRMEANLLTIAVAETIDNGKPLRETMAADIPL
AIDHFRYFAGAVRAQEGGISEIDHDTMAYHFHEPLGVVGQIIPWNFPILMAVWKLAPALA
AGNCVVLKPAEQTPASILVLLEMIGDLLPAGVLNVVNGFGLEAGKPLASSNRIAKIAFTG
ETTTGRLIMQYASQNIIPVTLELGGKSPNIFFEDVMSADDAFFDKALEGFAMFALNQGEV
CTCPSRVLIQESIYDRFMERALKRVAAITQGHPLDKGTMIGAQASQEQLEKILSYLDLGK
KEGAECLIGGERNMLGGDLAGGYYVKPTVFKGHNKMRIFQEEIFGPVVSVTTFKTEEEAL
EIANDTLYGLGAGVWSRDGARAFRMGRGIQAGRVWTNCYHAYPAHAAFGGYKQSGIGREN
HKMMLDHYQQTKNLLVSYSPNKLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggacatggcagaaatcgccaacctcggcatcgccaacccctacaagaagcagtacggc
aactacatcggcggccagtgggtccccccggtggacggccagtacttcgagaacagctcg
cccatcaacggccaggtgttcacctcggtgccgcgttccaacgacaaggacgtgaacgcc
gcgctggacgccgcgcacaaggccaaggcggcctggggcaagacctccacgacggaccgg
gccaacatcctgctgaagatcgccgaccgcatggaagccaacctgctgaccatcgcggtg
gccgaaaccatcgacaacggcaagccgctgcgcgagaccatggcggccgacatccccctg
gccatcgaccacttccgctacttcgcgggcgcggtgcgggcgcaggaaggcggcatcagc
gagatcgaccatgacacgatggcctaccacttccacgagccgctgggcgtcgtgggccag
atcattccctggaacttccccatcctaatggctgtctggaagctggcacccgccctggct
gccggcaactgcgtggtgctcaagcccgcggagcagacgccggcctccatcctggtcctg
ctcgagatgatcggcgacctgctgcccgccggcgtgctgaacgtggtcaacggcttcggc
ctggaggccggcaagccgctggcctccagcaaccgcatcgcgaagatcgccttcacgggc
gagaccacgaccggccggctcatcatgcagtacgccagccagaacatcatcccggtcacg
ctggagctgggcggcaagagccccaacatcttcttcgaggatgtgatgagcgccgacgac
gccttcttcgacaaggcgctggaaggcttcgccatgttcgcgctgaaccagggcgaagta
tgcacctgccccagccgcgtgctgatccaggaatcgatctacgaccgcttcatggaacgt
gccctgaagcgcgtggccgccatcacccagggccacccgctcgacaagggcaccatgatc
ggcgcgcaggcatcgcaggagcaactggagaagatcctctcgtacctcgacctgggcaag
aaggaaggcgccgaatgcctcatcggcggcgaacgcaacatgctcggcggcgacctggcc
ggaggctactacgtcaagcccacggtgttcaagggccacaacaagatgcgcatcttccag
gaagagatcttcggcccggtggtgtccgtcaccaccttcaagaccgaagaggaagcgctg
gagatcgccaacgacacgctctacggcctgggcgccggcgtgtggagccgcgacggggcg
cgcgccttccgcatgggccgcggcatccaggccggccgcgtgtggaccaactgctaccac
gcctaccccgcgcatgcggccttcggcggctacaagcagtccggcatcggccgcgagaac
cacaagatgatgctcgaccactaccagcagaccaagaacctgctcgtgagctacagcccg
aacaagctgggcttcttctga

DBGET integrated database retrieval system