KEGG   Aquifex aeolicus: aq_1394Help
Entry
aq_1394           CDS       T00013                                 

Gene name
lig
Definition
(RefSeq) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
aae  Aquifex aeolicus
Pathway
aae03030  DNA replication
aae03410  Base excision repair
aae03420  Nucleotide excision repair
aae03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:aae00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    aq_1394 (lig)
   03410 Base excision repair
    aq_1394 (lig)
   03420 Nucleotide excision repair
    aq_1394 (lig)
   03430 Mismatch repair
    aq_1394 (lig)
Enzymes [BR:aae01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     aq_1394 (lig)
    6.5.1.6  DNA ligase (ATP or NAD+)
     aq_1394 (lig)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     aq_1394 (lig)
DNA replication proteins [BR:aae03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    aq_1394 (lig)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     aq_1394 (lig)
DNA repair and recombination proteins [BR:aae03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     aq_1394 (lig)
   NER (nucleotide excision repair)
    Other NER factors
     aq_1394 (lig)
   MMR (mismatch exicision repair)
    Other MMR factors
     aq_1394 (lig)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 1192929
NCBI-ProteinID: NP_213963
UniProt: O67398
LinkDB All DBs
Position
complement(990701..992458)
Genome map
AA seq 585 aa AA seqDB search
MMEYRILAEFYERIEKTTSRIEMVSSLVELFKQTPKELIDKVVYLSIGKIAPEYTGLDYN
FGEKLAIRALSRVLKIPALEIEKRVRQEGDLGEAGRKLYEELGFKPEGTLTVEEVYNGLL
NIAKAVGIGSQERKISIFASLLKKATPLEAKYLLRTITERLRLGIGDNTILEALSIAFTG
SSVNREVVERAYNLTSDLGYVAKILAEKGLEGVKQVKIQVGRPVRPMLAERMSSPILILR
KLGGKCGAEYKYDGERIQAHRKGDEFYLFSRRLENITHQYPDLIEFLKEAIPHDFIVELE
AVVIDPASGEIRPFQELMHRKVKYVTKYHITKYPVAGFLFDIIYLDGEDLTLKPYPERRE
ILEKVVKRTDRIGLVPRKIVDNVEDLENFFYQAIEEGCEGLVCKSLAPNSIYQAGKRGFL
WIKYKRDYKSVLADTLDLVVVGGFYGKGQRKGTFGSLLMACYDPESDMFKTVTKVGTGFT
EDDFKKLEEILMPRKLNHRHPRVNSILEADMWFEPYLVLEITGAELTLSPVHTCGWGKVS
PNRGIGLRFPRFTGRYRFDKRPEDATTEQEIIEMYRMQRKIRVRS
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
gtgatggaatacagaatactggctgagttttacgagaggatagagaagacaacgagcagg
atcgaaatggtgagctccctcgtggagctcttcaaacaaactcctaaagaattaatagac
aaagtcgtttacctatcaataggtaagatagctcccgagtacacgggacttgactacaac
ttcggtgaaaagcttgccataagggctctttccagagtcctcaaaatacccgccctggaa
atagaaaagagagttaggcaagagggagatctgggagaggctggaaggaaactttacgaa
gagcttggctttaaacccgaagggacgctaaccgtagaagaggtttacaacggactctta
aacatagcaaaagccgtaggcataggctcgcaggagagaaagataagcatattcgcatct
cttttgaaaaaggcaacccctcttgaagctaagtaccttttgagaacgataacggaaagg
ctgagactcggaataggggacaacaccatactggaggctctttccatagcctttacggga
agttctgtaaacagggaagtggtggagagggcctacaacttgacttctgatctcggctac
gtggcaaaaatcctcgcggagaaaggactggaaggggtaaaacaggtaaagatacaggtg
ggaagacccgtaagacccatgctcgcagaacgtatgagcagtcccatactcatcctcaga
aagctcgggggaaagtgcggagcggagtacaagtacgacggggagagaattcaagcccac
agaaagggagatgagttttatctcttttcaaggagacttgagaatataactcaccagtac
ccggatcttatagagtttttaaaagaagcaataccccacgactttatagttgaactggaa
gcggttgttatagaccccgcaagtggtgagataagaccctttcaggaacttatgcataga
aaagtaaagtacgtaacgaagtaccacatcacgaaataccccgttgcaggctttctcttt
gacatcatataccttgacggtgaggacctaaccctgaagccctaccccgagaggagggaa
atcttagaaaaagtcgtaaagaggacggaccgtataggcctcgttcctagaaagatagtg
gacaacgtggaggatcttgaaaacttcttttatcaggcaatagaagagggatgtgagggg
ctagtttgtaagtcgcttgctcccaactccatataccaggcgggaaagagaggctttctc
tggattaagtacaagagagactacaagtcggtacttgcggacacgcttgaccttgtggtc
gtgggcggtttttacggaaaaggacagaggaagggaacgttcggttctctcttgatggcg
tgctacgaccctgaaagtgacatgtttaaaacagtgactaaagtgggaacgggatttacc
gaagacgacttcaagaaacttgaagagatactcatgccgaggaaactgaaccacagacac
ccgagggtaaattcaattctcgaagcggacatgtggtttgaaccctatctggttcttgaa
ataacgggagctgaacttactttgagtcctgttcacacgtgcgggtggggaaaagtctct
ccgaacaggggaattgggctgagatttccgaggtttaccggaaggtacaggttcgacaaa
agaccggaagacgcaaccaccgaacaggaaattatagaaatgtacagaatgcaaagaaag
attagagtaagatcctaa

DBGET integrated database retrieval system