KEGG   Apteryx australis mantelli (brown kiwi): 106482030Help
Entry
106482030         CDS       T04298                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam03030  DNA replication
aam03410  Base excision repair
aam03420  Nucleotide excision repair
aam03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:aam00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    106482030 (LIG1)
   03410 Base excision repair
    106482030 (LIG1)
   03420 Nucleotide excision repair
    106482030 (LIG1)
   03430 Mismatch repair
    106482030 (LIG1)
Enzymes [BR:aam01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     106482030 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     106482030 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     106482030 (LIG1)
DNA replication proteins [BR:aam03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    106482030 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     106482030 (LIG1)
DNA repair and recombination proteins [BR:aam03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     106482030 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     106482030 (LIG1)
   MMR (mismatch exicision repair)
    Other MMR factors
     106482030 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 106482030
NCBI-ProteinID: XP_013794996
LinkDB All DBs
Position
Un
AA seq 857 aa AA seqDB search
VLEQGENPTQEPPSLGHEDCDGQDPSSPSSCLLAAASPDGSSPDSASSAEDSPSAPDGSS
TSLPGIPRRRTARKQVPKRKMELASCAENGHAVDPDPKRWREEPGDECESDSTEAQEVRD
QSSEEAKEAEDGNGDREAQTSELPKPSKAVADFFAPRKGSRMKAEENAAPKTPAPKGSAP
ASIDGTNGTASSPSQVAEPLDPAQYNPSKSSYHPIHDACWAPGQRVPYLAVARTFERIEE
VSARLKNIETLSNFLRSVIALSPSDLLACVYLCLNRLGPAYEGLELGIGESILMKAVAQA
TGRQLEKIKSEAQEKGDLGLVAESSRSNQRTMFAPPKLSAAGVLSKLQEMARMTGNASMN
KKIDIIKALFVACRHSEARYIARSLSGKLRIGLAEQSVLVALAHAVSLTPPAQGWPPAVV
DASQGKSAEARKAWLEERSQILKQTFCELPNYAAIIPVLLEHGLESLPLHCKITPGIPLK
PMLAQPTKGIGELLKRFEEAAFTCEYKYDGERAQIHILESGAVYVYSRNQENTTSKYPDI
VTRIPKVKKASVQSCILDAEAVAWDPEKKQIQPFQVLMTRKRKDVEAAEIKVQVCLYAFD
MLYLNGESLVKEPFSKRRLLLHESFVETEGEFLFATSMDACSTDEISEFLDQSIKDSCEG
LMVKTLDVDATYEIAKRSHKWLKLKKDYLEGVGDTLDLVVIGAYLGKGKRVGMYGGFLLA
CYDEESEEYQSICKIGTGFTEESLEKHYGFLKDHVLAQPRPYYRWDSGAAPDHWLAAVQV
WEVKCGDLSISPVYKAAVGLVDEEKGISLRFPRFLRVREDKKPEEATSSSQVAELYKKQQ
QIQNQQLAEKGEDEDFY
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
gtgctggagcagggcgagaaccccacgcaggagcccccatccctgggacatgaggactgt
gatgggcaggaccccagctccccgtcctcctgcctgctggctgctgcgtccccggatggc
tcttctcccgacagtgcttcctcagctgaagatagcccctcagcccctgatggctcctcc
acctccctccctggcatcccccggcgcaggacagctcgtaagcaggtccccaagcgcaaa
atggagctggcgagctgtgcggagaatggacatgctgtggaccccgatcccaagcggtgg
agggaagagccgggagatgaatgtgaatcagacagcacggaggcgcaggaggtgagggat
cagagctcagaggaggctaaggaggcagaagatggcaatggggacagggaagcccagacg
tcagagctgccaaagcccagcaaagctgttgctgacttctttgcccccaggaaggggtcg
aggatgaaggcagaggaaaatgctgccccgaagacaccagccccaaagggttcggctccc
gccagcattgatggcaccaacgggactgcaagcagtccctcccaggttgccgagcctctg
gatccagcccagtacaacccctctaagagcagctatcaccccattcatgacgcctgctgg
gctcccgggcagagggtcccctacctggctgtggctcgtacctttgagcgcattgaggaa
gtctctgcccgcctgaagaacattgagaccctgagcaacttcctccgctcagtcattgcc
ctgtcaccgtctgacctcctggcctgtgtctacctctgcctgaaccgcctgggccctgcc
tatgaggggctggagctgggcattggggaaagcatcctcatgaaggctgttgcgcaggcc
acaggccgccagctagaaaaaatcaagagcgaggcccaggagaagggagacctggggctg
gtggccgagagcagccgcagcaaccagcggaccatgttcgcgccacccaagctgagcgct
gccggggtcctcagcaagctgcaggagatggccaggatgacaggcaatgcttcaatgaac
aagaaaatcgatatcatcaaggcattgtttgtggcctgccgccactccgaggctcgctac
attgcccggtcgttgagcgggaagctgcgcatcgggctggcggagcagtcggtgctggtg
gctttggcccacgctgtctcactgactcctccagcacaagggtggcccccagctgtggtg
gatgccagccagggcaagtctgctgaagcacgtaaagcctggctggaagagcggagccag
atcctcaagcagactttttgtgagctgccgaattatgctgccatcattcccgtgctgctg
gagcatgggctggagagcctgcccctgcactgcaagatcaccccagggatccccctgaag
cccatgctggcccagcccaccaaaggcattggggagctcctgaaacgcttcgaggaggcg
gccttcacatgcgagtacaagtacgatggcgagcgagcccagatccacatcctggagagc
ggggccgtgtacgtctacagccgcaaccaggagaacaccacctccaagtaccccgacatc
gtcacccgcatccccaaggtgaagaaggccagtgtgcagtcgtgcatcctggatgcagag
gctgttgcgtgggacccggagaagaagcaaatccagccattccaggtgctgatgacacgg
aagaggaaggatgtggaagctgctgagatcaaagtgcaagtgtgcctgtatgcctttgac
atgctgtacctcaatggggagtcgctggtgaaggagcccttctccaaacgccgcctgctg
ctgcatgagtcctttgtggagacggagggtgaattcctctttgccacctccatggatgcc
tgcagcactgatgaaatctctgagttcttggaccagtccatcaaggactcctgcgagggc
ctcatggtgaagactctggacgtggatgccacctatgaaattgcaaagcgatcccacaag
tggctgaagttgaagaaggattacctggaaggagtgggggacacgctagacttggtggtc
atcggtgcctacctggggaagggcaagcgcgtgggcatgtacgggggcttcctgctggcc
tgctacgatgaggagagtgaagagtaccagagcatctgcaagatcgggaccggcttcaca
gaggagagcctggagaagcactacggcttcctcaaggaccacgtcctggcccagccacgg
ccctactaccgctgggacagtggggcagcgcctgaccactggctggcggctgtgcaggtt
tgggaggtgaagtgtggtgacctctccatctcccctgtctacaaggcagctgtgggcctg
gtggatgaggagaaaggcatctcgctgcgtttcccccggttcctgcgtgtacgagaggac
aagaagccagaagaggccaccagcagctcccaggtggctgagctgtacaagaagcagcag
cagatccagaaccagcagcttgccgagaaaggggaggacgaggacttttactaa

DBGET integrated database retrieval system