KEGG   Apteryx australis mantelli (brown kiwi): 106486946Help
Entry
106486946         CDS       T04298                                 

Gene name
HKDC1
Definition
(RefSeq) hexokinase domain containing 1
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Neomycin, kanamycin and gentamicin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:aam00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106486946 (HKDC1)
   00051 Fructose and mannose metabolism
    106486946 (HKDC1)
   00052 Galactose metabolism
    106486946 (HKDC1)
   00500 Starch and sucrose metabolism
    106486946 (HKDC1)
   00520 Amino sugar and nucleotide sugar metabolism
    106486946 (HKDC1)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    106486946 (HKDC1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    106486946 (HKDC1)
Enzymes [BR:aam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     106486946 (HKDC1)
Membrane trafficking [BR:aam04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    106486946 (HKDC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 917 aa AA seqDB search
MFAVHLLAFYFTKLKEDQIKKVDRYLYHMRLSDDVLLDVMARFQAEMVKGLGRDTNPTAA
VKMLPSFVRSLPDGSEKGDFLAVDLGGSQFRALQVKVSDVGKQSTQLESKFYPTPKEVFQ
GNRAELFGYVADCLLDFMESKNLKHKKLPLGFTFSFPCRQTKLEEGVLLNWTKHFKVRGV
QGTDVVSSLRKALKKHKGIDVDVLALVNDTVGTMMTCGYDDQRCEVGLIIGTGTNACYME
EMRHIDLVEGDEGRMCINTEWGAFGDDGALDDLRTEFDRELDLGSLNPGKQLFEKMISSL
HLGELVRLILLKMTKEGLLFNGKVSTALCTKGKIEMRHMAAMEEYKEGLSNTKEILTELN
LFPSEEDCIAVQHVCTIVSFRSANLCAAALAAILTRLRENKKVLRLRTTVGIDGTLYKAH
PQYARRLHKVVRRLVPNCDVRFLLSTNGSARGAAMVTAVARRLAAQRKEIDAVLEPFLLS
PETLREVKNKMRTELEYGLKRETQGSATVKMLPTYVCGTPDGTEKGKFLALDLGGTNFRV
LLVKIRSGRRKSVRMYNKIFAIPLEIMQGTGEELFDHIVHCIADFLEYMGIKGARLPLGF
TFSFPCKQASIDKGTLVGWTKGFKATDCEGEDVVDMLREAIKRRNEFDLDIVAVVNDTVG
TMMTCGYEDPNCEIGLIAGTGSNVCYMEDMKNIEIVEGNEGKMCINTEWGGFGDNGCIDN
IRTEYDKEVDEGSLNPGKQRYEKMTSGMYLGEIVRQILIDLTKRGLLFRGQISESLRKRG
IFETKFLSQIESDRLALLQVRQILQQLGLDSTCEDSIIVKEVCGAVSRRAAQLCGAGLAA
IVEKKRENRGVEHLQITVGVDGTLYKLHPHFSRVLQETVKELAPRCDVTFMLSEDGSGKG
AALITAVAKRLRNVGEN
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgtttgctgtccacttgctagctttctattttacaaaactaaaagaagatcaaataaaa
aaggttgacaggtacctgtatcacatgcgcctctccgacgatgtcctgctggacgtgatg
gctcgcttccaggccgagatggtgaagggcctggggagagacacgaaccctacagcagcg
gtgaaaatgctgccgtcgtttgtgcgctcgctgcccgacggctcagagaagggcgacttc
ctcgccgttgacctgggtggctcccagtttcgtgcccttcaggtgaaggtgtctgatgtc
gggaagcagagcacccagctagagagcaaattttaccccacacccaaggaagtcttccag
gggaacagagccgagctcttcggttatgtcgctgactgcctgctagacttcatggagtcc
aaaaacctgaagcataagaagttacctcttggctttacattttcttttccatgccgacag
accaaactggaagagggggtgctccttaactggacaaaacactttaaggtccgaggcgtt
cagggcacggatgtggtcagctctctgcgcaaggccctcaagaagcataagggcatagac
gtagatgtcttggcactggtcaatgacaccgtgggaaccatgatgacttgtggatatgat
gaccagcgctgtgaagttgggcttataatcgggacaggcaccaacgcctgctacatggag
gagatgaggcacatcgacctggtggaaggcgacgaggggaggatgtgcattaacacggag
tggggggccttcggggacgacggtgctttggatgacctccgcacagagtttgatcgagag
cttgacctgggatctctcaatcctggaaaacaactgtttgagaagatgattagcagcctg
cacctgggcgaacttgtaagactcattcttctaaaaatgacgaaggaaggtctgctcttc
aatgggaaagtgtcaacggccctgtgtactaagggcaagatcgaaatgaggcacatggct
gcaatggaagaatataaggaaggtttgagcaacacgaaagagatacttacagagctgaac
ctctttccctctgaagaggactgcattgccgttcagcatgtctgcaccatcgtttccttc
cgctcggccaacctctgcgctgcagccttagcagccatactgacacgactgagagagaat
aaaaaagtgttaaggctgcgaaccactgttgggattgatgggaccctctataaagcccac
ccccagtacgctagacgtctgcacaaggtggtgagaaggctggtcccaaactgcgacgtt
cggttcctcctgtctacgaacggcagcgcgaggggggccgccatggtcacagcggtggca
cgcaggctggccgcgcagcgtaaggagatcgacgccgttcttgaaccgtttctgctctcc
ccggagaccctccgagaagtgaagaacaaaatgagaacggagctggaatacgggctaaag
agagagacgcaaggcagtgccacagtgaagatgttgcccacgtatgtctgcgggaccccg
gatggaacagagaaaggaaagttccttgcccttgatcttggtgggacaaatttcagggtt
ctgctggtcaaaattagaagcgggagaaggaaatcggtgcgaatgtataacaaaatcttt
gccattcctttggagatcatgcaagggacaggggaagagctctttgaccacattgtgcat
tgcatagcagactttttggagtatatggggattaaaggtgcccggctgcctctgggcttc
accttctccttcccctgcaagcaagccagcattgacaagggaacacttgtaggttggaca
aaaggttttaaggcaacggattgcgagggggaagatgttgttgatatgctgagggaagcc
atcaagaggagaaatgagtttgacttggacattgtagcagtggtgaatgacactgttggg
acgatgatgacatgtgggtacgaggatccaaactgtgagatcggcctcattgcaggaaca
ggcagcaatgtgtgctacatggaagacatgaaaaacatagaaatagtggaagggaatgaa
ggaaaaatgtgcattaatacagaatggggaggatttggtgacaacggctgcattgacaac
atcagaacagaatatgataaagaagtagatgaaggttcactaaatccagggaagcagagg
tatgaaaaaatgaccagtggaatgtatctaggtgaaatagtgaggcaaattttgatcgac
ttaaccaaacgaggactgctgttcagaggacagatttcagaatcactcaggaaaagaggc
atatttgaaacaaaattcctatctcagattgagagcgaccggctagccctcctgcaagtc
cggcagatcctgcagcagctcggcctggacagcacgtgcgaagacagcatcatcgtcaag
gaggtgtgcggagccgtttccaggagagctgcccagctctgtggggcaggactggcggct
atcgtagagaagaagagagaaaaccgaggcgtggagcacttgcaaatcaccgttggagtg
gacgggactctatacaagctccatccacatttttctagggtgctgcaggaaacggtgaag
gaactggcgccgcggtgtgatgtgactttcatgctctctgaagatgggagtgggaaggga
gctgcgctcattaccgcagtggcgaaaagattgcgtaatgttggagaaaactaa

DBGET integrated database retrieval system