KEGG   Apteryx australis mantelli (brown kiwi): 106497416Help
Entry
106497416         CDS       T04298                                 

Gene name
ACE
Definition
(RefSeq) angiotensin I converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Brite
Enzymes [BR:aam01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     106497416 (ACE)
Peptidases [BR:aam01002]
 Metallo Peptidases
  Family M2
   106497416 (ACE)
Exosome [BR:aam04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106497416 (ACE)
CD molecules [BR:aam04090]
 Proteins
  106497416 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 1382 aa AA seqDB search
MGSCAVGELHSGRVLMWVFCRWSQHSGKDPQEDTDVEASLEEQNFTEAWGKKAKELYGNI
WSNFSDSELRKIIGSIQTLGPSNLPLEKREQHRGARPRPGRLEAPTSSKLLGSPVAGASR
RRPRHPACNRRRQSFLTASETDKADDAPLSASGPSRLCLSILPKSHVPLASQVEASLEEQ
NFTEAWGKKAKELYGNIWSNFSDSELRKIIGSIQTLGPSNLPLEKREQYNTILSDMDKIY
STAKVCQTNGTCWELEPDISEIMANSRSYKKLLYAWEGWHNAAGNPLRAKYEEFVKLSNE
AYQMDGFKDTGEYWRSWYDSLTFEDDLEQLYHQLEPLYLNLHAFVRRKLYDRYGPKYVNL
KGPIPAHLLGNMWAQQWNNIYDMMIPYPEKPNLDVTSTMVQQGWNATHMFRVSEEFFTSL
GLLEMPPEFWEKSMLEKPTDGREVVCHASAWDFYNRKDFRIKQCTTVTMEQLFTVHHEMG
HVQYYLQYKDQPVSFRSGANPGFHEAIGDVMSLSVSTPSHLKKIGLLNSVTEDTESSINY
LLKMALEKIAFLPFGYLIDQWRWNVFNGRTPPSRYNYDWWYLRTKYQGICSPVSRNESNF
DPGAKYHIPGNTPYIRYFVSFILQFQFHKALCQAANHTGPLHTCDIYMSKEAGTKLSNVL
KAGSSKSWQEILLNLTGTDKMDAGALLEYFSPVTEWLQQQNNKTNEVLGWPEFDWRPPIP
EGYPEGIDKIADEAQAKEFLSEYNRTAEEVWNAYTEASWTYNTNITDHNKEIMLEKNLAM
SKHTLQYGMRARQFDSTDFQDQSVTRILKKLSVIERAALPEDELKEYNTLLSDMETTYSI
AKVCRENKICHPLDPDLTDMLASSRDYDELLFAWKGWRDASGKMIRDKYKRYVALSNKAA
MLNGYADNGAFWRSLYETPTFEEDLERLYLQLQPLYLNLHAYVRRVLYKKYGPERVNLKG
PIPAHLLGNMWAQSWSNIFDLVMPFPGATKVDATPAMKEQGWTPKRMFEESDRFFTSLGL
IPMPQEFWDKSMIEKPTDGREVVCHASAWDFYNRKDFRIKQCTVVNMDDLITVHHEMGHV
QYFLQYMNQPISFRDGANPGFHEAVGDVMALSVSTPKHLHSIKLLDQVTDNEESDINYLM
SVALDKIAFLPFGYLMDQWRWKVFDGRIKEDEYNQQWWNLRLKYQGLCPPVPRSEDDFDP
GAKFHIPANVPYIRYFVSFVIQFQFHQALCKAAGHTGPLHTCDIYQSKAAGSLLGEALKL
GFSKPWPEAMQLITGQPNMSAEALMSYFEPLMTWLAKENEKNGDVLGWAEYDWTPYAATQ
ARDSSDQADFLGMSLASSQATAGGWVLLALALIFVVTTILLGIKLFSSRRRAFKSSSEME
LK
NT seq 4149 nt NT seq  +upstreamnt  +downstreamnt
atggggagctgcgcggtnggggagctgcacagcggccgtgtcctcatgtgggtcttctgc
aggtggtcgcagcacagtggcaaagacccccaggaggacacggacgtggaggcttccctg
gaggagcagaacttcactgaggcctgggggaagaaagccaaggagctctatggcaacatc
tggagcaacttcagtgactcagagctgaggaagatcatcggctccatccagaccctgggg
ccctccaacctgcccctggagaagagagagcagcacagaggtgcacggccccggcccggg
aggctggaggctcccacctcctccaagctgctcgggtccccggtggctggagccagccga
cggcgtcccagacatcctgcctgcaacaggcgcaggcagagcttcctgacggccagcgag
acggacaaggcggatgacgctcccttaagtgcttctggtccatcgcggctctgtctctcc
atcctccccaaatcccatgtccctcttgcctcgcaggtggaggcttccctggaggagcag
aacttcactgaggcctgggggaagaaagccaaggagctctatggcaacatctggagcaac
ttcagtgactcagagctgaggaagatcatcggctccatccagaccctggggccctccaac
ctgcccctggagaagagagagcagtacaacaccatcctgagcgacatggacaaaatctac
tccacggccaaggtgtgccagaccaacggtacctgctgggagctggagccagacatctcg
gaaatcatggccaactcccgcagctacaagaagctgctctacgcctgggagggctggcac
aatgcagcaggcaacccgctgcgggccaagtacgaggagttcgtgaagctgagcaacgag
gcctaccagatggatggattcaaggacacgggcgagtactggcgctcctggtacgactca
ctcacctttgaggacgacctggaacagctctatcaccagctggagccactctacctcaac
ctgcatgccttcgttcggaggaagctctatgaccgctatggcccaaaatacgtcaacctg
aagggtcccatccctgctcacctcctgggcaacatgtgggctcagcagtggaacaacatc
tatgacatgatgatcccctacccagagaagcccaacctcgatgtcacgagcaccatggtg
cagcagggctggaacgccacccacatgttccgggtctcagaggagttcttcacctccttg
gggctgctggagatgccccccgagttctgggagaagtccatgctggagaagccaacggat
gggcgggaggtggtgtgtcacgcctcagcctgggacttctacaaccgcaaagacttcagg
atcaagcagtgcaccacagtcaccatggagcagctgttcacggtgcaccatgagatgggc
cacgtgcaatattacctgcagtacaaggaccagcctgtctccttccgcagcggggccaac
cctggcttccacgaggccattggcgatgtcatgtccctgtctgtctccactcccagccac
ctcaagaaaattgggctcctcaacagtgtcactgaggacacagagagcagcatcaattac
ttgctgaagatggccttggagaagatcgctttcctgcccttcggctacctcattgaccag
tggcgctggaacgtgttcaatggccgcacgccccccagccgttacaactacgactggtgg
tatctgagaaccaaataccaaggtatctgctctccagtttcgaggaacgaaagcaacttt
gaccctggtgcaaagtaccacatccctgggaacaccccgtacatcaggtactttgtgagc
ttcatcctccagttccagttccacaaggcgctgtgccaggcagccaaccacactggtccc
ctgcacacctgtgacatctacatgtccaaagaggctggaaccaaactcagcaatgtgttg
aaagctggctcttccaagtcatggcaggagatcctgctgaacctcactggcacagataag
atggatgctggggccctcctggagtacttcagccctgtcaccgagtggcttcagcagcag
aacaacaagaccaatgaggtgctgggctggcctgaatttgattggcgtcctcctatccct
gaaggctaccctgaaggcattgataaaatagcagatgaagcacaagctaaagagttcttg
tccgagtacaacagaacagccgaggaggtgtggaatgcttataccgaggcatcctggacc
tacaacaccaacatcaccgaccataacaaggagatcatgctggagaagaacttggccatg
tctaagcacacccttcagtatggcatgagggccaggcagttcgactccactgacttccag
gaccaaagtgtcacacgcatcctcaagaagctgagtgtcattgagagggcagcactgccc
gaggatgagttgaaggagtacaacaccctcctctcagatatggagaccacatacagcata
gccaaggtctgcagggagaacaaaatatgtcaccccctggaccctgacctcacagacatg
ctggcttcctcacgggactatgacgagctcctctttgcctggaagggctggcgggatgct
tctgggaagatgatcagggacaaatataagcgatacgtggcactgagcaacaaggcagcc
atgctcaatggctacgcagacaatggggccttctggagatccctgtatgagacacccacc
tttgaggaagatctggagagactgtacctgcagctgcagcccttgtatctcaacctgcat
gcttatgtacgccgagtcctctacaaaaagtatggtccagagcgtgtaaacctgaagggt
cccatccctgctcacctgctaggcaacatgtgggcccagtcgtggtccaacatttttgac
ctggtgatgcccttcccgggggccaccaaggtggatgccaccccagccatgaaagaacag
ggctggacacccaagaggatgtttgaagagtcagaccgtttctttacatctctgggcctc
atccccatgccacaggagttctgggacaagtcgatgattgagaagccaacagacgggcgg
gaggtggtgtgtcatgcctcagcctgggacttctacaaccgcaaggacttcaggatcaag
cagtgcacggtggtgaacatggatgacctaatcacagtgcaccatgagatgggccacgtg
caatacttcctgcaatacatgaatcagcccatctcattccgtgatggggccaaccccggc
ttccacgaggctgttggggatgtcatggccttgtccgtctccacccccaaacatttgcac
agcatcaaactgctggaccaagtcacagacaatgaagaaagcgacattaactacctgatg
agcgtcgccctggacaagattgcctttctgcccttcggctatctcatggaccagtggcgc
tggaaggtgtttgatggacggatcaaggaggatgagtacaaccagcagtggtggaatctc
aggctgaagtaccaaggcttgtgcccaccagtgcctaggtctgaagatgattttgaccct
ggggccaagttccacatccctgccaacgtcccatacatcaggtactttgtcagcttcgtg
atccagttccagttccaccaggcgctctgcaaggcagctgggcacacggggcccctgcac
acatgtgacatctaccagtccaaggcagctgggagcctcctgggggaagccctgaagctg
ggtttcagcaagccatggcccgaagctatgcagctcatcactgggcagcccaacatgtct
gcagaggccctgatgagctactttgagccactcatgacctggctggccaaggagaatgag
aagaacggggatgtcctgggctgggccgagtacgattggaccccttacgcagctactcaa
gcacgagacagctctgaccaagctgatttcctgggcatgtctctggccagcagtcaagcc
acagcgggtggctgggtcctgcttgccctggcactcatcttcgtggtcaccaccatcctc
ttgggcatcaaattgttctcatccaggagaagggccttcaaatccagctcagaaatggaa
ctgaaataa

DBGET integrated database retrieval system