KEGG   Arthrobacter alpinus: AOC05_00520Help
Entry
AOC05_00520       CDS       T04095                                 

Definition
(GenBank) hypothetical protein
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
aaq  Arthrobacter alpinus
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:aaq00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    AOC05_00520
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AOC05_00520
Enzymes [BR:aaq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     AOC05_00520
Bacterial toxins [BR:aaq02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   AOC05_00520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
141151..142710
Genome map
AA seq 519 aa AA seqDB search
MPFLLNTSAGTLIAGTDVNRATTGDSADNIDAALRRKANASSQAPAAGWDPATVPSALHM
KDYADEPGYKQSSASVIDGAIVQDTLNTQRIFTLTDAFPWNGGVFEKLNVLADGGVQGGR
ARSMAYGDGFATIAGKKYLLLSSQNIKGSADGLTNNINNNTDRSKFDYVADVNGPKDSSG
RISVYNLQGTPRPYSSTATHVSDSNLALGTLTNYSLDAEFALFNSGTPLIVQQKSTSGGG
LQVPLKIFYEASPLQMYNTSYILQTHSDDDGQSWVSDQLISGMVKRENSRWYLLGPGRSI
QIQKGAFAGRLVVPVYYQGGTSTEVIFSDDNGKTWSHGEPLPTSLASHESSVVELPDGSL
QIYVRNTSSSGGKVLTSASGNGGASWRAVGSAFGDNSAGINSQISTVTLQAPVVSPTTGT
AQPAFLMTTAMSSARTNGVANIGLVHEDGNYAGGAKKYRIEWIKQYQLTGANEKFAYSSM
AQLNNGKVGILYEAAPTGSWSDGLQAMYYRELEISDLLN
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atccctttcctactcaacacatccgctggtacgttgattgcggggactgacgtcaacagg
gccacgacaggcgactccgcagacaatatcgatgccgccctccggcgtaaggcgaacgct
tcatcacaggctcctgcggcaggctgggaccccgcgacggttccctccgcgttgcatatg
aaggactatgctgacgaacctggttacaaacagtccagcgcttcggtgattgacggcgca
attgttcaggacacgctaaatacccagcgcatttttacactgaccgacgcgttcccctgg
aatggcggtgtatttgaaaaactaaacgttcttgccgacggcggcgtccagggcggtcga
gcccgcagcatggcctacggggacggttttgccacgattgctggcaaaaagtacttgctg
ttgtcgagtcagaacatcaaaggcagcgccgacggcctgacaaacaacatcaacaacaac
accgatcgttcgaaatttgactacgttgccgacgtcaacgggcccaaggactcctccggt
cgaatctccgtttacaacctccaaggaacgccgcggccctattcgtccactgccacgcat
gtgtccgactcgaatctggccctcggaacactcaccaactattctctagacgccgaattt
gccctcttcaactcagggacgcccctgatagtgcagcagaaatcaacgagcggtggcgga
ctacaagtaccgctgaagatcttttacgaagcctcgccgttgcagatgtacaacacgagc
tacattttgcagacccactcggacgacgacgggcagagctgggtttcggaccaattgatc
tcaggcatggtgaaacgggaaaactccaggtggtacttgcttggcccgggacgatccatc
cagattcagaaaggggccttcgccggccggctcgtcgttccggtctactaccaaggtgga
acgtcgaccgaagtaatcttcagcgatgacaacggcaaaacctggagccatggggaaccg
cttcccacgtcactggcaagccacgagtcctcggtcgtcgaactccccgatggaagcctg
caaatctacgtccgcaacacttcctccagcggcggtaaggtactgacctctgcaagcgga
aacgggggagcgagctggagggccgttggctccgcctttggcgacaattctgcgggaatc
aattcccagatctcaacggtgacactccaggccccggtcgtttcgccaaccaccggcacg
gcgcagccagccttcctgatgacaaccgcgatgtctagtgccaggaccaacggcgtcgcg
aatatcggcctcgttcatgaggacggcaactacgccggcggagccaagaagtaccgcatc
gagtggatcaagcaatatcaactgacaggcgcgaacgagaagttcgcatactcttcaatg
gcccagctaaacaacggcaaggtcgggattctttatgaagctgcgccgaccggttcttgg
tccgatggacttcaagccatgtattatagagaacttgagatcagcgaccttctaaactaa

DBGET integrated database retrieval system