KEGG   Paenarthrobacter aurescens: AAur_0636Help
Entry
AAur_0636         CDS       T00447                                 

Definition
(GenBank) BNR/Asp-box repeat domain protein
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
aau  Paenarthrobacter aurescens
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    AAur_0636
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AAur_0636
Enzymes [BR:aau01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     AAur_0636
Bacterial toxins [BR:aau02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   AAur_0636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
651982..654996
Genome map
AA seq 1004 aa AA seqDB search
MARNTSSLHVVVSHPPARSSFERTSDLRSCSSPLARIAAVGTVSLGLLAGLGLPATAAPI
PPSNPAAAPGAFTEANIGADRTAANFFYRIPALTYLGNNVVLAAWDGRPGSAADAPNPNS
IVQRRSTDGGQTWGPVTVIAAGHVGDASGPKYGYSDPSYIYDAEAGKVLAFFVYSKDQGF
GGSQFGNNDADRTVISSAVIESSDGGVTWSQPRLITNVTKPGTSKTSPVAGDVRSNFASS
GEGIQLKYGQYKGRLIQQFAGDIRQTDGTNKIQAYSVYSDDHGATWHKGANVGDRMDENK
TVELSDGRVLLNSRDNANQGYRKVAISTDGGATYGPVTQDTELPDPANNGAIARMFPNAA
QGSADAKKLIFTNANSKTGRENVSARVSCDDGATWPGVRTIRSGFSAYSTVTRLENDKFG
VLYEGNYTDNMPFAKFDDAWLNYVCAPLAVPAVTTAPGATQQVPVTVTNQEAATLSGASA
TVYTPSGWSATTVPVPDVAPGASVTVNVALTAPANASGPQNLNAAFTTANGRVSQFTFTA
TVPAAPQVGLAITGTAPARDVVASPYQMGDVLSYSLNVKSTANVTANSVPVSGTFDSGFL
PPSAPNCRFNNLAAGASYTCTTAKHVITAADIQRGYFVPEASFSITASSTPSLTKTVPFT
GAAVALRDGLLTADISGARADVGRDLATQPYAAGDQVPYAFTVKNTSPLVEKVVPTAGNF
SPFLPEGPGNCRYSVLPAGQSYQCATPRHTVTAEEAEQGFFIPKTTWEVSSAGQSTKTIT
VDGGEVDLKVREPKLEGTVSAEWSDADGDRFASVGDPVTYTYTVGNAGNVAVTGLEAPDA
GISAATLPAGDTVTATRERVLTAADVAAGSLGAVSFEATAWNGSRAVAAAAGSDPLALAV
QPARPDSVPTLTVQELGTPPTDLGTADKYRTGQKVVLKGLEYGNWYYVYLNKTGYRLGWI
FPTTDNAVEFILPSDVKNGRDDAVVLDKDGGQVSFDRLQVTPKG
NT seq 3015 nt NT seq  +upstreamnt  +downstreamnt
gtggcacgtaacacaagtagtctgcacgtcgtcgtttcgcatcctcccgctcgaagcagt
ttcgaaaggacatcggatttgagatcctgttcatcacctctcgcccgcatcgccgccgtc
ggcaccgtcagcctgggccttctggccggcttgggccttcccgccaccgctgcacccatt
ccgcccagcaaccccgcggcagctcccggtgcattcaccgaggccaacatcggcgctgac
cgtacggccgccaacttcttctaccggattccggccctgacctatctgggcaacaacgtg
gtgctcgcggcctgggacgggcgtccgggctcggccgcggatgcccccaacccgaactcg
atcgtgcagcgccgcagcaccgacggcggccagacgtggggacccgttaccgtcatcgcc
gcgggacatgttggcgatgccagcggacccaaatacggatacagcgacccctcctacatt
tacgatgccgaagccggcaaggtcttagccttcttcgtgtactccaaggaccagggcttc
ggcggcagccaattcggcaacaatgacgccgacaggactgtgatctcctcggcagttatc
gagtcctcggacggcggcgtcacgtggagccagccccgactcatcaccaacgtcaccaag
ccgggcaccagcaagaccagccctgttgccggcgatgtcaggtccaacttcgcatcctcc
ggcgaaggcatccagctcaagtacggccaatacaagggccgcctgatccagcagttcgcc
ggcgatatccgccagacggacggcaccaacaagatccaggcatactccgtttactccgat
gaccatggcgccacctggcacaagggcgccaacgtcggggaccgcatggatgagaacaaa
accgtggaactttccgacggccgcgtgctcctgaactcacgggacaacgccaaccagggc
taccgcaaggtggccatttccacggacggtggcgccacatatggcccggtcacgcaggac
accgaactcccggatcccgccaacaacggcgccattgcgcggatgttccccaacgctgcg
cagggctcggctgatgccaagaagctcatcttcaccaacgcgaactccaagaccggccgc
gaaaacgtctcggccagggtctcctgtgacgacggcgccacctggccgggcgtccgcacc
atccgttcgggtttctccgcctactccacggtcacccgtctggaaaacgataagttcggt
gtgctctacgagggcaactacacggacaacatgccgttcgcgaagttcgacgacgcctgg
ctgaactacgtctgtgccccgctggctgtcccggctgtcaccaccgcgccgggggccacc
cagcaggtgcccgtgactgtcaccaaccaggaagccgccacactttcgggcgccagcgcc
accgtctacacacccagcggctggtcggccaccacggtgccggttcccgacgtcgccccc
ggcgcttcggtgaccgtcaacgttgccctaacggcaccggccaacgccagcggtccgcag
aacctcaatgcagccttcacgacggcgaacggccgggtttcgcagttcaccttcaccgca
acggtgccggcagctccgcaggtaggcctcgccattaccgggacggcacccgcccgcgat
gtcgtggccagcccctaccagatgggcgacgttctcagctactcgctcaacgtcaagagc
accgccaacgtcacggccaattcagtaccggtttccgggacgttcgactccgggttcctg
ccgccgtcggcccccaactgccggttcaacaatctggccgcaggtgccagctacacctgc
accaccgccaagcacgtgatcacggcagccgacatccaacgcggctatttcgtgccggag
gccagcttcagcatcacggcaagctcgacgccgtcgctgaccaaaacggtaccgttcacc
ggcgctgcggtggccttgcgtgacggcctgctgacggccgatatcagcggggcgcgcgcc
gacgtcggacgtgatctggcaacccagccatacgcggccggcgaccaggtcccatatgcc
ttcacggtgaagaacacgagtccgctggtggagaaggtggtccccacagccggtaacttc
agcccgttcctgccggaagggcccggcaactgccgctacagtgtgctcccggccggccaa
agctaccagtgtgccaccccgcgccacaccgtgaccgcagaagaagccgagcagggtttc
ttcattccgaagaccacctgggaggtcagctcggccggtcaaagcaccaagaccattacg
gtggacggcggcgaagtggacctcaaggttcgcgagcccaagctggagggaaccgtgtct
gccgagtggagcgacgctgacggcgaccgcttcgcgagcgtcggcgatcccgtgacgtac
acgtacacggtgggcaacgccgggaacgtcgcagtgaccggattggaggcgcccgacgcc
ggcatctcggcggccacgctgcctgccggtgacaccgttacggctacacgagagcgtgtg
ctgacagccgcggacgttgctgcggggagtttgggtgctgtctcatttgaagcgacggcc
tggaatggttcacgggcagttgcggccgcagccgggagtgacccgctggcgctcgccgtt
cagccagcgcgtccagactctgtgccgacactgactgtccaggagttgggcacgccgccg
acggacctcgggactgcggataagtaccgcacgggccagaaggtagtgctcaagggcttg
gagtacgggaattggtactacgtgtacttgaataagacgggctaccggctcggatggatt
ttccccaccacggataacgcagtggagttcattcttccgtcggacgtgaagaacggccgg
gatgacgcggtggtcctggacaaggacggcggccaagtctccttcgaccgcctgcaggtg
acccccaagggctag

DBGET integrated database retrieval system