KEGG   Paenarthrobacter aurescens: AAur_1201Help
Entry
AAur_1201         CDS       T00447                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
aau  Paenarthrobacter aurescens
Pathway
aau00020  Citrate cycle (TCA cycle)
aau00480  Glutathione metabolism
aau01100  Metabolic pathways
aau01110  Biosynthesis of secondary metabolites
aau01120  Microbial metabolism in diverse environments
aau01130  Biosynthesis of antibiotics
aau01200  Carbon metabolism
aau01210  2-Oxocarboxylic acid metabolism
aau01230  Biosynthesis of amino acids
Module
aau_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aau_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AAur_1201
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AAur_1201
Enzymes [BR:aau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AAur_1201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ABM06743
UniProt: A1R425
LinkDB All DBs
Position
1279730..1281949
Genome map
AA seq 739 aa AA seqDB search
MAKIIYTHTDEAPMLATYSFLPIVEAYASTAGVEVETRDISLAGRIIAVFGDFLTEEQRT
GNALAELGELAKQPEANIIKLPNISASVPQLKAAIAELQAQGYALPDYPDNPSSDTETDI
RSRYDKIKGSAVNPVLREGNSDRRAPLSVKNYARQNPHSMGAWSADSKTNVATMGENDFR
SNEKSVVLKADDSLSIQLVREDGTTKVLKKDFPVLAGEVVDATVLRADALDEFLKAQVAR
AKEEGVLFSAHLKATMMKVSDPIIFGHVVKAYFSELFETYGKQLAAAGISPNNGLAAILS
GLEDLPEDVRDGVKAAITKGLEDGPALAMVDSDKGITSLHVPSDIIVDASMPAMIRSSGH
MWGPDGKEADTLAVIPDSSYAGIYQVVLDDCRANGAFDPTTMGTVPNVGLMAQAAEEYGS
HDKTFEIQAAGTVQLVDSKGNVLTEHQVFPGDIWRACQTKDIPVRDWVKLAVTRARASQT
PAVFWLDETRAHDANLIAKVNEYLKDHDTEGLEIKILSPVEATAFTLERIRKGEDTISVT
GNVLRDYLTDLFPILELGTSAKMLSIVPLINGGGLFETGAGGSAPKHVQQLVKENHLRWD
SLGEFLALAVSFEHLATTTGNARAQVLADTLDRATGTFLLENKSPRRSVGELDNRGSHFY
LATYWAQELAKQTEDAELAKDFAAIAEALTSNEEAIVGELAAVQGTAVDLGGYYRPDAAK
AAEIMRPSATFNKVLATLK
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atggccaagattatctatacccacacagacgaagcgccgatgctggcaacttactcattc
ctgccgattgttgaagcgtatgcctcgaccgcaggagtagaggtggagacccgcgatatt
tcgctggccggccgcatcatcgccgtcttcggtgatttcctgacagaagaacagcgcacg
ggcaacgcgcttgctgaacttggtgaactggcaaagcagccggaagccaacatcatcaag
ctgcccaacatcagcgcctccgtgccgcagctcaaggctgccatcgccgaactccaggcc
cagggctacgccctcccggactacccggacaacccctcctcggacaccgagacggatatc
cgctcgcgttacgacaagatcaagggttccgccgttaacccggtgctgcgtgaaggcaac
tcggaccgccgcgcaccactgtcggtgaagaactacgcccgtcagaacccgcactccatg
ggtgcctggtccgctgattcgaagaccaacgttgccaccatgggcgagaacgacttccgc
tccaacgagaagtccgttgtcctcaaggccgacgattccctgagcatccagttggtccgc
gaagacggcaccaccaaggtcctcaagaaggacttccccgtactggccggcgaggttgtg
gacgctaccgtcctccgcgccgacgccctggatgagttcctcaaggcccaggttgcccgc
gccaaggaagagggcgttctcttctccgcacacctgaaggccaccatgatgaaggtctcg
gaccccatcatcttcggccacgtggtcaaggcttacttctccgagctgttcgaaacctac
ggcaagcagctcgcagccgcaggcatcagcccgaacaacggcctcgcagcgatcctcagc
ggcctggaagacctgcccgaggacgtccgcgatggcgtcaaggcagccatcaccaagggc
ctcgaagacggtccggcactggccatggtggactcggacaagggcatcaccagcctgcac
gttccgtcggacatcattgttgacgcctccatgcctgccatgatccgttcctccggccac
atgtggggcccggacggcaaggaagccgacaccctggcggtgatcccggacagctcctac
gccggtatctaccaggttgtgctggacgactgccgtgccaacggcgcattcgaccccacc
accatgggcaccgttcccaacgtgggcctcatggcacaggcagccgaagaatacggcagc
cacgacaaaaccttcgagatccaggcagctggcaccgtccagctcgtggacagcaagggc
aacgtcctcaccgagcaccaggtcttccccggtgacatctggcgcgcatgccagaccaag
gacatcccggtccgcgactgggtcaagctggccgtcacccgcgcccgcgcttcccagact
ccggctgtgttctggctggacgagacccgcgcccacgacgccaacctcatcgccaaggtc
aacgagtacctcaaggaccacgacaccgagggcctggaaatcaagatcctttccccggtt
gaagccacggccttcacgctggagcgcatccgcaagggtgaggacaccatctccgtcacc
ggtaacgtgctccgcgactacctcacggacctgttcccgatcctcgagctcggtaccagc
gccaagatgctctccatcgttccgctgatcaacggtggcggcctcttcgagaccggcgcc
ggtggctccgctcccaagcacgtccagcagctggtcaaggaaaaccacctccgctgggac
agcctgggcgagttccttgctttggccgtcagcttcgagcaccttgccaccaccaccggc
aacgcccgcgcacaggtcctcgctgacacgctggaccgcgccacgggtacgttcctgctg
gaaaacaagtccccgcgccgcagcgtcggcgagctggacaaccgcggcagccacttctac
ctggccacgtactgggcccaggaactggccaagcagaccgaagacgccgagttggccaag
gacttcgcggcaatcgctgaagccctgacctccaacgaagaggcaatcgtcggcgagctg
gccgcagtccagggtaccgccgtcgacctgggcggttactaccgtccggacgctgccaag
gccgctgagatcatgcgcccgtcggctacgttcaacaaggtcctcgcgaccctgaagtag

DBGET integrated database retrieval system