KEGG   Acidovorax citrulli: Aave_3230Help
Entry
Aave_3230         CDS       T00451                                 

Definition
(GenBank) Aldehyde dehydrogenase (NAD(+))
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
aav  Acidovorax citrulli
Pathway
aav00010  Glycolysis / Gluconeogenesis
aav00620  Pyruvate metabolism
aav01100  Metabolic pathways
aav01110  Biosynthesis of secondary metabolites
aav01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aav00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aave_3230
   00620 Pyruvate metabolism
    Aave_3230
Enzymes [BR:aav01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Aave_3230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA LuxC
Motif
Other DBs
NCBI-ProteinID: ABM33792
JGI: Aave3230
UniProt: A1TS54
LinkDB All DBs
Position
3560397..3561917
Genome map
AA seq 506 aa AA seqDB search
MDMAEIANLGIANPYKKQYGNYIGGQWVPPVDGQYFENSSPINGQVFTSVPRSNDKDVNA
ALDAAHKAKTAWGKTSTTDRANILLKIADRMEANLLTIAVAETIDNGKPLRETMAADIPL
AIDHFRYFAGAVRAQEGGISEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAVWKLAPALA
AGNCVVLKPAEQTPASILVLLEMIGDLLPPGVVNVVNGFGLEAGKPLASSNRIAKIAFTG
ETTTGRLIMQYASQNIIPVTLELGGKSPNIFFEDVLAADDAFFDKALEGFAMFALNQGEV
CTCPSRVLIQESIYDRFMERALKRVAAITQGHPLDKSTMIGAQASQEQLEKILSYLDLGR
QEGAECLIGGERNMLGGDLAGGYYVKPTVFKGHNKMRIFQEEIFGPVVSVTTFKTEEEAL
EIANDTLYGLGAGVWSRDGARAFRMGRGIQAGRVWTNCYHAYPAHAAFGGYKQSGIGREN
HKMMLDHYQQTKNLLVSYSPNKLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggacatggcagaaatcgccaacctcggcatcgccaacccctacaagaagcagtacggc
aactacatcggcggccagtgggttcccccggtggacggccagtacttcgagaacagctcg
cccatcaacggccaggtgttcacctcggtgccgcgttccaacgacaaggacgtcaacgcc
gcgctggacgccgcgcacaaggccaagaccgcctggggcaagacctccacgacggaccgc
gccaacatcctgctgaagatcgccgaccgcatggaagccaacctgctgaccatcgcggtg
gccgaaaccatcgacaacggcaagccgctgcgcgaaaccatggccgccgacatcccgctg
gccatcgaccacttccgctacttcgcgggcgccgtgcgggcgcaggaaggcggcatcagc
gagatcgaccacgacaccgtggcctaccacttccacgagccgctgggcgtcgtgggccag
atcatcccctggaacttccccatcctgatggccgtctggaaactggcccctgccctggcc
gccggcaactgcgtggtgctcaagcccgcggagcagacgcccgcctccatcctggtgctg
ctggaaatgatcggcgacctgctgcccccgggcgtggtcaacgtggtcaacggcttcggc
ctggaggccggcaagccgctcgcctccagcaaccgcatcgcgaagatcgccttcacgggc
gagaccaccaccggccggctcatcatgcagtacgccagccagaacatcatcccggtcacg
ctggagctgggcggcaagagccccaacatcttcttcgaggacgtgctggccgccgacgac
gccttcttcgacaaggcactggaaggcttcgccatgttcgcgctgaaccagggcgaggtc
tgcacctgccccagccgcgtgctgatccaggagtcgatctacgaccgcttcatggaacgc
gccttgaagcgcgtggccgccatcacccagggccatccgctcgacaagtccaccatgatc
ggcgcgcaggcctcgcaggagcagctggagaagatcctctcgtacctcgacctgggcagg
caggaaggcgccgaatgcctgatcggcggcgagcgcaacatgctcggcggcgacctggcc
ggcggctactacgtcaagcccacggtgttcaagggccacaacaagatgcgcatcttccag
gaggaaatcttcggcccggtggtatccgtcaccaccttcaagaccgaggaggaagcgctg
gagatcgccaacgacacgctctacggcctgggcgccggcgtgtggagccgcgacggcgca
cgcgccttccgcatgggccgaggcatccaggccggccgcgtgtggaccaactgctaccac
gcctatcccgcgcatgcggccttcggcggctacaagcagtccggcatcggccgcgagaac
cacaagatgatgctcgaccactaccagcagaccaagaacctgctcgtgagctacagcccg
aacaagctgggcttcttctga

DBGET integrated database retrieval system