KEGG   Altererythrobacter atlanticus: WYH_02746Help
Entry
WYH_02746         CDS       T03925                                 

Gene name
ykoU
Definition
(GenBank) putative ATP-dependent DNA ligase YkoU
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
aay  Altererythrobacter atlanticus
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:aay00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    WYH_02746 (ykoU)
Enzymes [BR:aay01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     WYH_02746 (ykoU)
DNA repair and recombination proteins [BR:aay03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     WYH_02746 (ykoU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2851314..2853836
Genome map
AA seq 840 aa AA seqDB search
MARGKSDPLAEYNRRRDFSRTAEPAGKMGQSNGKRRFIVQKHDASRLHWDFRLEVDGVLK
SWAVTKGPSADPDIKRLAVRTEDHPLAYAEFEGTIPEQEYGGGTVMLWDRGTWEPIEGKK
AEDLEEGHLHFILHGERMKGEWLLVRMKPRKGEKRENWLLRKIDDDYAEGGDKLIDTCLT
SVLTGRPMAEIAADEGGEHSLKGKKGEDFAQEMKRAACHNRGKAKRRKSTAKPPAFRKPQ
LATLVDAVPSGNGWMHEIKFDGYRAMVSASGEKVAVYTRSGKDWTDKFGPLAQAIAALDL
PPCLIDGEIVAYDGKGNPDFSTLQKLLKRGKGGQGASDKLAFHAFDLLELDGEDLAPLPN
VERKERLEALLRDAGPPVHVADHVIGAGEKLYEKMCDAGQEGIISKKIDARYTSRRGKAW
VKVKCTRRQEFVIIGWTKSSARGRPFASLVLGQYEDGDLTYKGKVGTGFDADTLEDLARK
FKSLERKTPPVETDRAEARGVTWLTPKLVAEVAFAEFTAEGRVRHASFLGLRSDKKAKEV
KPERPADPPEESEAETVRISSRDRVIFPESGQTKGDLADYYARIAPLMLPFLSGRPVSLV
RCPQGRAKKCFFQKHDTGGFGDHVHHVPIREKDGGTEDYIYVEDATGILACVQMGTIEFH
GWASRSRDVEAPDRMIFDLDPDEGLDFEDVKSAAVDIRDRLAEIGLTSFAMLSGGKGVHV
IAPLRPGHSWEAHKDFAKRFSEALAMADPDRFTATMSKAKRKGKIFIDWLRNQRGSTAVV
PYSARARENAPIAAPIAWGELKNMASAHEFTIDDAKKLLTRAGGKGLSGWGFADQSLPDL
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcggcaaatccgatccgctggcggaatataaccggcggcgcgatttttcccga
acggcggaacctgccgggaagatggggcagagtaacggcaagcgccgcttcatcgtgcag
aagcacgacgcctcccgcctgcattgggatttccggctggaagtggacggcgtgctgaaa
agctgggccgtgaccaagggcccttcggccgatcccgatatcaagcggctggccgtgcgg
acggaagatcatccgctggcatatgccgagtttgaaggcacgatcccggaacaggaatat
ggcggcggcaccgttatgctgtgggaccggggcacgtgggaaccgattgaaggcaagaag
gcggaagatctggaagaagggcatctccatttcatcctccatggcgagcggatgaagggg
gaatggctgctggtccgcatgaaaccgcgcaagggcgagaaacgcgagaactggctgctg
cgcaagatcgacgatgattatgcggagggcggcgacaagctgatcgacacatgcctgacc
agtgtcctgaccgggcggcccatggcggaaatcgccgcggacgagggtggggagcattcg
ctgaaaggcaagaagggcgaggatttcgcccaggagatgaagcgggccgcctgccacaac
cggggcaaggcgaaacgccgtaaatccactgcgaagccacccgcttttcgcaagccgcaa
ctggccacgctggtggatgccgtgccttccggcaatggctggatgcatgaaatcaagttc
gacggctatcgcgcgatggtttccgccagcggggaaaaggtggcggtctatacacgcagc
gggaaggactggacggacaagttcggcccgctggcacaggccatcgccgcgctggatctg
ccgccctgcctgatcgacggtgagatcgtcgcctatgacggcaagggcaatccggatttc
tcgacgctgcagaaactgctgaaacgcggcaagggcgggcagggcgcaagcgacaagctg
gccttccatgccttcgatctgctggaactggatggggaggatctggcgccgctgccgaat
gtggaacgcaaggaacggctggaggccttgctgcgcgatgccgggcccccggtccatgtg
gccgatcacgtgatcggcgcgggcgaaaaactgtatgagaaaatgtgcgacgccgggcag
gaaggcatcatctccaagaagatcgacgcgcgctacacatcccgccggggcaaggcctgg
gtgaaggtcaaatgcacgcggcggcaggaattcgtgatcattggctggacgaaaagctct
gccagggggcgccccttcgcatcgctggttctggggcagtatgaagacggcgatctgacc
tacaagggcaaggtcggcacgggtttcgatgccgacacgctggaagatctggcccgcaag
ttcaaatcgctggagcgcaagacgccgccggtcgaaaccgaccgggccgaagcgcgcggc
gtgacctggctgaccccgaaactggtggccgaagtggcctttgccgaattcactgccgaa
gggcgcgtgcgccatgccagtttcctcggccttcgcagcgacaagaaggcgaaggaggta
aagccggaacgcccggccgatccgcctgaggaaagcgaggcggagacggtaaggatcagc
agccgcgatcgtgtcattttcccggaatcaggccagaccaagggtgatctcgctgattac
tacgcccggatcgcgccgctgatgctgcctttcctttcgggcaggcccgtcagcctggtg
cgctgcccgcaggggcgggcgaagaaatgcttcttccagaaacacgatactggcggtttc
ggggaccatgtccatcacgttccgatcagggagaaggacggcggcacggaggattatatc
tatgtggaggatgccacgggcattcttgcctgcgtgcagatgggcacgattgaatttcac
ggctgggccagccgcagccgcgatgtggaagcgccggaccggatgatcttcgacctcgat
cccgatgaagggctggatttcgaggatgtaaaaagcgccgccgtcgatattcgcgatcgg
ctggccgaaatcggcctgaccagcttcgccatgctttcgggcgggaagggcgtgcatgtg
attgccccgttgcggccgggccattcgtgggaagcgcacaaggatttcgcgaaacgcttt
tccgaggcgctggccatggctgatcccgatcgcttcaccgcgacgatgagcaaggccaag
cgcaagggaaagatattcatagactggctgcgcaatcagcgcggatcgaccgcggttgtc
ccctattccgcccgcgcacgcgaaaatgcgccaattgccgcgcccatcgcctggggcgaa
ttgaagaacatggccagcgcgcatgaattcaccatcgacgatgcgaagaaattgctcact
cgtgccgggggcaaggggctgtccggctggggttttgccgatcaatccctgcctgacctc
tag

DBGET integrated database retrieval system