KEGG   Candidatus Koribacter versatilis: Acid345_3693Help
Entry
Acid345_3693      CDS       T00352                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
aba  Candidatus Koribacter versatilis
Brite
Enzymes [BR:aba01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Acid345_3693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
4369001..4369612
Genome map
AA seq 203 aa AA seqDB search
MAHEVPPLPYDYSALEPTIDTQTMHLHHDKHHLAYVTNLNAALEKAPELQSKSAEDLLKD
LNSVPEAIRTAVRNNGGGHVNHSMFWAIMGPNAGGEPTGEIADAINSTFGSFATLKEKFN
EAGVKQFGSGWAWLVKGADGKLAVTSSPNQDNPISQGQFPILGNDVWEHAYYLKYQNRRA
DYLKEWWNVVNWTEVNRRLKQAK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcccacgaagtcccaccgttgccgtatgactattcggcgctggagcccacgatcgac
acgcagacgatgcatttgcaccatgacaaacatcacctggcgtatgtaacgaatttgaac
gccgcgctggaaaaggcgcctgaactgcaaagcaagagcgcggaagatctgttgaaggac
cttaattccgttcctgaagccattcggacagcggtccgtaacaatggcggcggacatgtg
aaccactcgatgttctgggcgatcatgggcccgaacgcgggcggcgagccgaccggcgag
attgccgacgcgatcaactccacgttcggcagcttcgcgacactcaaagaaaagttcaac
gaagccggcgtgaagcagttcggcagcggttgggcgtggcttgtgaagggagccgacggc
aagttggcggtcaccagctcaccgaaccaggacaatccgatctctcagggacagttcccg
atcctcggcaacgacgtctgggagcacgcctattatttgaagtaccagaaccgccgcgca
gattacctgaaggaatggtggaacgtggtgaactggacggaagtgaatcgtcggctgaaa
caagccaagtag

DBGET integrated database retrieval system