KEGG   Luteitalea pratensis: LuPra_00431Help
Entry
LuPra_00431       CDS       T04394                                 

Definition
(GenBank) Angiotensin-converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
abac  Luteitalea pratensis
Brite
Enzymes [BR:abac01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     LuPra_00431
Peptidases [BR:abac01002]
 Metallo Peptidases
  Family M2
   LuPra_00431
Exosome [BR:abac04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LuPra_00431
CD molecules [BR:abac04090]
 Proteins
  LuPra_00431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2 DUF1488
Motif
Other DBs
NCBI-ProteinID: AMY07264
UniProt: A0A143PHN4
LinkDB All DBs
Position
502822..504660
Genome map
AA seq 612 aa AA seqDB search
MRNRRLLVASSAVVAGLGLAAACSRVSAPGNSAATSASDPVGFVAKANATLLEQAGTLAR
AQWVAANFITEDTEQISAAATADYVATSMRLAKQAASYGTTGGGNADVARQLLLLKLAAS
PLPAPADDALQKELTRIVAGMEAAYGRGRYCPPGKECQTIDDLSRLMASNRDPKVLLDAW
EGWHAIGTPLKQPYERFAQLGNQGAKELGFADLGAFWRAGYDMPPDDFAKEVDRLWAQVK
PLYDQLHAHVRRRLAAKYGTDVVPLDGPIPGHLLGNMWAQQWGNIYDLVGPPGRAPGYDL
AGLLKAKKTDAIGMVKYGEGFFTSLGFASLPETFWKRSLIVRPRDRDVVCHASAWDVDNV
DDLRIKMCIEINAEDFVTVHHELGHNFYQRAYNQQPFLYRTGANDGFHEAIGDAVALSIT
PQYLVKIGLLPTAPKAQDDVEFLLRMALDKVAFLPFGLLVDQWRWKVFSGEIPPAQYNAA
WWALREKYQGVAAPGPRPADAFDAGAKYHVPANTPYTRYFLAHILQFQMHRAMCKAAGHT
GPLHTCSIYGNRAVGARLQKMLAMGASKPWPEALEALTGEKQMDATAILEYFEPLRAWLE
AEAKKGEGTGKK
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcaatcgacgcctcctcgtcgcctcctccgcggtcgtggcaggcctcggcctcgcg
gccgcctgctcgcgggtctcggctcccggcaattccgcggcgacatccgctagcgatccc
gtcggcttcgtcgcgaaggccaacgcgaccctcctcgagcaggccggcacgctcgctcgc
gcgcagtgggtcgccgcaaacttcatcaccgaggacaccgagcagatttccgccgcggcg
acggccgattacgtcgccacatcgatgcgccttgccaagcaggccgccagttacggcacc
accggcggcgggaatgccgacgtcgcgcgccagttgctgctgctcaagcttgccgccagc
ccgctccctgcaccggcagacgatgcgctccagaaggaactcacccgcatcgtcgccggc
atggaagccgcttacggacgcggcaggtactgcccaccgggcaaggaatgccagacgatc
gacgacctgagtcgcctgatggcgagcaaccgcgatccgaaagtgctcctcgacgcatgg
gaggggtggcatgccatcgggacaccgctgaaacagccgtacgaacgattcgcgcaactg
ggcaaccagggcgcgaaggaactcgggttcgccgatctcggtgctttctggcgcgcgggc
tacgacatgccgcccgacgacttcgcgaaggaagtcgatcggctgtgggcgcaggtcaag
ccgctctacgatcagttgcacgcgcacgtgcgacgtcgcctcgccgcgaagtacggtacg
gacgtcgtgccgctcgatggcccgatccccggacacctgctcggcaacatgtgggcgcag
caatggggcaacatctacgacctcgtcggcccgccgggccgtgcccccggctacgacctc
gccgggttgctgaaggcgaagaagaccgacgccatcggcatggtgaagtacggcgagggc
ttcttcacctcgctcggtttcgcgtcgctgcccgagaccttctggaagcgttccctcatc
gttcgtccgcgcgaccgcgatgtcgtctgccacgccagcgcgtgggacgtcgacaacgtc
gacgatctccgcatcaagatgtgcatcgagatcaacgcggaggacttcgtcaccgtccac
cacgaactcggtcacaacttctaccagcgtgcctacaaccagcagccgttcctctatcgc
accggcgccaacgacggcttccatgaggcgatcggcgatgccgtggcgctctcgatcacg
ccacagtacctggtgaagatcgggctgctgccgacggcgccaaaggcccaggacgatgtg
gagttcctgctgcggatggcgctggacaaggtggcgttcctgccattcggcctgctcgtc
gatcagtggcggtggaaggtattcagtggcgagattccgccggcgcagtacaacgccgca
tggtgggcgttgcgcgagaagtaccagggcgtggcggcaccggggccgcgccccgcagac
gccttcgacgcaggggcgaagtaccacgtgcctgccaacacgccctacacgcggtacttc
ctcgcgcacatcctccagttccagatgcatcgggcgatgtgcaaggctgccggccacacc
ggaccgctgcatacctgctcgatctacggcaacagggcggtcggcgctcgcctccagaag
atgctcgcgatgggcgcgagcaagccctggcccgaggcgctcgaagcgctgaccggcgag
aagcagatggacgccacggccatcctcgaatacttcgagccgctgcgcgcctggctggag
gcagaggcgaaaaagggagaagggacagggaagaagtga

DBGET integrated database retrieval system