KEGG   Luteitalea pratensis: LuPra_00817Help
Entry
LuPra_00817       CDS       T04394                                 

Gene name
sodA
Definition
(GenBank) Superoxide dismutase [Mn]
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
abac  Luteitalea pratensis
Brite
Enzymes [BR:abac01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     LuPra_00817 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
936820..937416
Genome map
AA seq 198 aa AA seqDB search
MPYELPPLPYAHNALEPFIDEQTMQIHHGKHHQTYVNNVNAALEKYPELQGKPIDQLIAD
LNAIPEDIRTAVRNNGGGHANHTFFWAVMAPNAGGSPTGKIAEAINAKFGSFDAFKEAFA
KAGTTRFGSGWAWLIKSGSGVEVTSTPNQDSPLMEGKMPLLGLDVWEHAYYLKYQNKRPD
YIAAWWNVVNWDAVNNAF
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgccctacgaacttccgccgctgccctacgcccacaacgcgctcgagccgttcatcgac
gagcagacgatgcagatccatcacggcaagcatcatcaaacctacgtgaacaacgtcaat
gccgcgctcgagaagtaccccgaactccagggcaagccgatcgatcagctgatcgccgac
ctgaacgcgatcccggaagacatccgcacggccgtgcgcaacaacggcggcgggcatgcc
aaccacacgttcttctgggcggtcatggcgcccaacgccggcggttcgccgacaggaaag
atcgccgaggcgatcaacgccaagttcggctccttcgatgcgttcaaggaggcgtttgcc
aaggccggcacgacgcgtttcggcagcggctgggcgtggttgatcaagagcggcagcggc
gtggaggtgacaagcacgccgaaccaggacagcccgctgatggaaggcaagatgccgctg
ctcggcctcgacgtctgggagcacgcgtactacctgaaataccagaacaagcgccccgac
tacatcgccgcgtggtggaacgtggtcaattgggacgcagtcaataacgcgttctag

DBGET integrated database retrieval system