KEGG   Acinetobacter baumannii BJAB0868: BJAB0868_03698Help
Entry
BJAB0868_03698    CDS       T02728                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
abaj  Acinetobacter baumannii BJAB0868
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:abaj00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BJAB0868_03698
  Energy metabolism
   00680 Methane metabolism
    BJAB0868_03698
Enzymes [BR:abaj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BJAB0868_03698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3890903..3893587
Genome map
AA seq 894 aa AA seqDB search
MVQQIDAPLREDVRLLGNLLGETLKQHAGQALFNQIEQIRALAKGARDGQAEAEKQLEQL
FLELPDEELLPLTRAFSHFLNFANIAEQYHVVRSRRQAEFDPDANSPNPLVHLFKKFKDK
NISTEKLFQQICDLKIELVLTAHPTEVSRRTLIQKYDDINACLSQLDQQKLTPRERQNAL
ANLKQQISSAWQTDEIRQHRPTPVDEAKWGFATIEQTLWNAVPKFIRELNELVQDNCQQN
LPLHIAPVRFASWMGGDRDGNPNVTHQITQEVLWLSRWQAADLYLRDIENLRWELSIQSC
SEEMVQAIGSPHPEPYREYLRATRERLKATRHWLAQRLQGLEADDSNVIKSKDELLQPLL
LCYRSLIDSNLPEIANGQLLDFIYRVNCFGIELLKLDIRQESGRHRQAISAITEYLGLGN
FESWTEQARQNFLIQELQSKRPLLPKYINEPEGSLIGHPDVQEVFATMRTLADQPPESLG
AYIISMAEYPSDVLAVLLLQKEAGIQHPLRVVPLFETLKDLDGAATTMNTLFNMHWYKQH
IQGKHEVMIGYSDSAKDAGFMSANWAQYRAQEELTAIARKHGVQLTLFHGRGGSISRGGA
PTQQALFSQPPGSISGAIRVTEQGEMIRFKFGLEGIAMQNLEIYTAATLEATLLPPPEPK
AEWRELMNRMTDHSVKVYRQTVRENPHFVKYLRTVTPELELQMLPLGSRPAKRKVSGGIE
SLRAIPWVFAWTQIRLMLPAWLGTGAAINEVIADQQKATLDEMLQQWPYFQTLIDMLEMV
LSKADANIALYYESHLTEDEDLKVLGNQLRQRLKDAVETLLTLKDESKLLSDNEVLDQSM
QVRKPYLLPLHLLQAELMKRRRDYLAERQAEHTPVDHALMVSIAGIAAGLRNTG
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atggttcagcaaatcgatgcgccactgcgtgaggatgtccgcttacttggcaatttatta
ggtgaaaccctaaaacagcatgcaggacaagcactgtttaatcagatcgagcaaatccgt
gctcttgccaaaggtgcacgtgatggtcaagctgaagccgaaaagcaattagaacaatta
tttttagaattgcccgatgaagagctattgcctcttacccgcgctttttctcacttcctc
aattttgccaatattgctgagcaatatcatgtggtacgtagccgcagacaggcagagttc
gatccggatgcaaactccccgaatccccttgttcacttatttaaaaagtttaaagataaa
aatatttcgacggaaaaactgttccagcaaatttgtgatcttaagattgaattggtactt
acggcgcatccaacagaagtgagtcgtcgtaccctgattcaaaaatatgacgatatcaat
gcttgtctatcacaacttgatcagcaaaaacttactccgcgtgaacgacaaaatgctctt
gccaatttaaaacaacaaattagttcggcttggcaaacagatgaaatcaggcagcaccgc
ccgaccccggtagatgaagcaaaatggggctttgccacaattgagcaaacgctttggaat
gctgttcctaaatttatccgtgagctaaatgaactggtccaagacaattgccaacaaaac
ttaccacttcatattgctccggtacgttttgcatcttggatggggggagaccgtgatggt
aacccgaacgttactcatcaaattacccaagaagtattgtggttatcacgctggcaagct
gccgacctctatctaagagatatcgaaaacttacgttgggaactatcaattcagtcttgt
tccgaagaaatggttcaagccattggtagtcctcatccagagccttatcgtgagtattta
cgtgcaacacgtgagcgtttaaaagcaactcgtcattggttagctcagcgcctacaaggc
ttagaagctgatgacagcaatgtcattaaaagcaaagatgaactgttacaaccattattg
ctgtgctatcgctctctaattgacagtaatctgcctgaaatcgcgaatggtcaactactc
gactttatctaccgtgtgaactgttttggtattgaactgcttaagctcgatattcgccaa
gaatcaggccgtcatcgccaagccatttcagcaattaccgaatacttaggtctgggtaat
tttgagtcatggactgaacaagcgcgccaaaacttccttattcaggagctccaaagcaaa
cgcccgctactaccgaagtatattaatgagccagaaggtagtttgattggtcacccagat
gtacaagaagtatttgcaaccatgcgtactttggcagaccaaccacctgagtctttaggg
gcttatattatttctatggctgaatatccaagtgatgttttagctgtattgttattgcaa
aaagaagccggtattcagcatcctttacgtgtagtgcctttatttgagactttaaaagac
ttagacggcgcagcaactaccatgaatacgttgttcaatatgcattggtataagcagcat
attcagggtaaacacgaagtgatgatcggctactcggactcagcaaaagatgctggtttc
atgtctgctaactgggcccaataccgtgctcaagaagagctgactgcaattgctcgtaaa
cacggcgtacagttgactctgttccacggtcgtggcggctcaattagccgtggtggtgct
ccaacgcaacaggctctcttttcgcaaccaccgggctcaatctctggtgcaattcgtgtg
acagaacaaggtgaaatgattcgcttcaaattcggtctagaaggtattgccatgcaaaat
cttgaaatctataccgcagcaacgcttgaagcgacattattaccaccaccagagcctaag
gctgagtggcgtgaacttatgaaccgtatgacagatcattctgtgaaggtttatcgtcaa
acagtgcgtgaaaacccgcattttgtgaaatatttacggactgtcactcctgagcttgaa
ttacaaatgttaccgctaggttcacgtccggcaaaacgtaaagtaagtggaggtatcgaa
tctttacgtgccattccatgggtatttgcttggacacaaatccgtttgatgttacctgca
tggttaggtacaggtgcggcgattaatgaagtgattgctgatcagcaaaaggcaacgctt
gatgaaatgcttcagcaatggccttatttccagacactcattgatatgctggaaatggta
ttgtctaaagccgatgccaatattgcactctactacgagtctcatttgactgaagatgaa
gacttaaaagtgcttggcaatcagttacgccaacgtctaaaagatgctgtggaaacctta
cttacgttaaaagatgaatcaaaactattaagcgacaatgaagttttggatcagtctatg
caagttcgtaaaccttatttactgcctttgcatcttttacaagctgaactcatgaaacgc
cgccgtgattatcttgctgaacggcaggcagaacatacccctgttgaccatgcacttatg
gtaagtattgccggaattgctgctggtttacgtaatacaggctaa

DBGET integrated database retrieval system