KEGG   Trichophyton benhamiae: ARB_00773Help
Entry
ARB_00773         CDS       T01611                                 

Definition
(RefSeq) hypothetical protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
abe  Trichophyton benhamiae
Pathway
abe04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:abe00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    ARB_00773
Enzymes [BR:abe01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ARB_00773
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 9522969
NCBI-ProteinID: XP_003012891
UniProt: D4AX46
LinkDB All DBs
AA seq 212 aa AA seqDB search
MVKAGELSSVASPASSSIPVTLVREFEQDWLSASGSGSGSLPSLSHVPAELTPSCAVVIC
RAVAVVRGDSNVKGTVTFEQESETAPTTISWNITGHDPNAQRGFHIHQFGDNTNGCTSAG
PHFNPFGKTHGAPTDEVRHVGDLGNITTDDQGNAVGSVQDQHIKLIGEHSVVGRTIVCHA
GTDDLGKGGNEESLKTGNAGPRPACGVIGIAA
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaagcaggtgagctaagcagcgtcgcatctcccgcctcttcctccatccctgtc
accctggtgagagaatttgagcaggactggctgtccgcctctggctctggctctggctct
ctcccctctctctcgcacgttcctgctgagctgacgccttcttgcgctgttgttatttgc
cgagcagttgccgtcgtccgtggtgactccaacgtcaagggcaccgtcaccttcgagcag
gagtcggagaccgcgcccaccaccatctcatggaacatcaccggccatgatcccaacgcc
cagcgtggcttccacatccaccagtttggtgacaacaccaacggctgcacatcggccggc
cctcacttcaaccccttcggcaagacccacggtgctcccacagatgaggtccgccacgtt
ggtgacttgggtaacatcaccaccgatgatcagggcaacgcggtcggatccgttcaagac
cagcatatcaagctgatcggtgaacacagcgttgttggccgtaccattgtctgccatgca
ggcaccgacgatcttggcaaaggtggaaacgaggagtccttgaagactggcaacgctggt
cctcgtcctgcctgcggtgtcattggtatcgctgcttag

DBGET integrated database retrieval system