KEGG   Trichophyton benhamiae: ARB_02816Help
Entry
ARB_02816         CDS       T01611                                 

Definition
(RefSeq) histone-lysine N-methyltransferase Clr4
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
abe  Trichophyton benhamiae
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    ARB_02816
Enzymes [BR:abe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     ARB_02816
Chromosome [BR:abe03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     ARB_02816
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    ARB_02816
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 474 aa AA seqDB search
MVTVLDSDSDEETFIQPEVISSRLLKAFISPEDDRQRQSPSKPPSKPRRAVVDKGSTSSS
SRPQSKASNVSVVIPVPPRRPSPSPVTTSRKRSLSSDGDINKALSRKLTATKIPDHHGLS
DFYAVESGEVKRPYLKLKTFDPKKTEIPRSSKRYIPPKRRSDKESACSRLEELYNKKLQR
IKGPPIRFKAGKIAKEIDFNFDFIDSYKIHSGVNQIDPEFLWGCDCTKCDAECDCLSKDL
VHYEKGRRVRAVLKSEILNKRTALIRECSSRCKCSGVNCWNHVVFRGRQVELEVFQTKNR
GFGVRSPHSIERGQFIDTYVGEVIEPSTSDAREEAIDVEKYSSYLFSLDYFPGEEYEKEK
DIYVVDGRKFGSITRFMNHSCNPNCKMFPATQTDDHGVYQLAFFAVRDIPAGTELTFDYH
PGWEGGDVDPDATKCLCGEKNCRGQLWPAKRKTTRPGEDSSSSGESSEESEDDE
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggttaccgtcctggactcagactcagacgaggagacttttatccaacctgaagtgata
tcaagccggctgctcaaggcattcatcagccccgaagacgacaggcagaggcagtcgccg
tctaaaccgccgagcaagccaagacgtgctgttgttgacaagggctcaacatcttccagt
tcccgcccacagtccaaggcctcaaatgtttcggtagtcatccctgtgccacctcggcgg
ccaagtccttcgccagtgactaccagccgtaagagatctctatcgtctgatggagatatc
aacaaagccttgtctcggaagcttacagcaactaaaatcccggaccaccatggtctaagt
gatttctacgccgtggagagtggagaggtaaaaagaccgtaccttaagttaaaaacattc
gacccaaagaagactgagataccccggtcaagcaagcggtatattccgcccaagagacgc
agtgataaagagtcagcgtgctctcgcttagaagagctatataataagaagcttcaacgg
atcaagggccccccaatccggtttaaggctggcaagatcgcaaaagagatcgattttaat
tttgattttatcgactcctataaaattcacagcggggttaaccagattgatccggagttc
ctatggggctgcgattgtacaaaatgtgatgctgaatgcgactgcctctctaaagaccta
gttcattatgagaagggtcgacgtgtacgggccgtcttaaagtcggagatcctgaataag
cgtacggcattgatccgagaatgctcgtcgcgctgcaaatgctctggagtcaactgctgg
aatcatgttgtcttccgtgggcgacaagttgaattggaagttttccagaccaagaaccgg
gggtttggagtccgctcgcctcattctatagagcgagggcagttcattgacacttatgtc
ggcgaggttattgagccatccactagcgatgccagagaagaagcaattgatgtggaaaaa
tactctagctacttgttctcactcgactacttccctggtgaggagtatgagaaggagaag
gatatctatgtcgttgatggacgcaagtttggttcaattaccaggttcatgaaccactcc
tgcaacccaaactgcaagatgtttcctgccactcagacagacgaccacggggtctaccag
cttgcattcttcgcggtccgcgacatacctgccggcactgagttgacgtttgactatcat
cctggctgggaagggggtgacgttgacccagacgcgacgaagtgtctctgtggtgagaaa
aactgccgtggccagctctggccggcaaaacggaaaactacacgacctggtgaagatagt
tcttcttctggcgagtcttccgaggagtctgaggatgatgaatga

DBGET integrated database retrieval system