KEGG   Trichophyton benhamiae: ARB_05411Help
Entry
ARB_05411         CDS       T01611                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
abe  Trichophyton benhamiae
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    ARB_05411
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ARB_05411
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ARB_05411
   00430 Taurine and hypotaurine metabolism
    ARB_05411
Enzymes [BR:abe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     ARB_05411
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 546 aa AA seqDB search
MERPEEVRKERVVGFVEQADRASQVPGQKNNDDSRPKILDFKPPEELKAVFSEGLTSSGQ
GHDGLVRIVDDLLKYSVNTWQQGFLDKLYSSPNAPGLAAELLLGTLNANVHVYQSAPALT
VIEKVTTRRFAELFGLTGPNAGGISVQGGSASNTTAIVVARNTLFPDTKKNGTGDHRFVI
FTSAHGHYSIEKAAQMIGLGSNAVHSVPVDREGRMIPQKLDEEIQKAKDDGKTPLFVNAT
AGTTVLGTFDPFTEIAGICRKHKIWFHIDGAWGGAFIFSNRQKHKLEGSHMADSIAINPH
KMLGVPLTCSFLLGADMTQFHGSNTLPAGYLFHNDVSDGSEVWDLGDLTLQCGRRGDALK
MFLNWNYIGSSGYEERIDAASDVAVHLCNLISESPDLILLSENPPPCFQICFFYAPFKQM
VHSSDKVADEAERGKLNGEITSMIADDLIEQGFMVDYAPPAAAQVEGDGKYLRCVINLHT
KKETVERLVEVVLQLGAKAVRKQRGLELNGTFVNPNQAPAPGQRPKHPLEMGRGPQGAPA
ASDFVL
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggagcggcctgaagaagtgcggaaagaacgcgttgttggatttgttgagcaggcagat
cgcgcgtcccaggtaccaggacagaagaataatgatgattctcggccaaagattctggat
tttaagcccccggaagagctcaaagcagtgtttagtgaaggcttaacaagctcaggacag
ggacatgatgggcttgttcgaattgtagatgaccttctcaaatattccgtcaacacatgg
cagcaaggatttctggacaagctttactcatcaccaaacgctcctgggttggccgcagag
ttacttcttgggacattgaatgccaatgtgcacgtctaccagtcggccccagcattgacg
gtcatcgaaaaagtgaccacaagacgatttgctgagcttttcggtcttacaggacccaac
gctggcggaatctctgtccagggagggtctgcatccaacactacagcaatcgttgtagca
aggaacactctatttcccgataccaagaagaatggaacgggtgaccatcgatttgttata
tttaccagtgcgcatgggcactacagcattgaaaaagctgcgcaaatgatcggcctagga
agcaacgcggttcacagtgtacctgtcgaccgtgaaggacgaatgattccacagaagctt
gatgaggagattcagaaggcaaaggacgatggtaaaactcccctcttcgtcaatgccact
gccgggactactgttctagggacatttgatccatttacggaaatcgcggggatttgccgc
aaacataaaatctggttccacattgatggtgcttggggaggtgcttttatcttttctaac
cgccagaaacacaagcttgaaggttcacatatggctgatagtattgccataaatcctcat
aaaatgcttggagtaccattgacttgctcgttcctattgggcgccgatatgactcaattc
cacggatcaaacacgcttcctgcagggtatctcttccataacgatgtgtctgatggctcc
gaggtatgggatttgggtgacttgactttacaatgcggccgtcgaggtgatgccctgaaa
atgttcctaaactggaattacatcggctcatcaggatacgaagaacgaattgatgctgca
agtgatgtcgctgtccatctctgcaacctcatatcggaatccccggatttaattctcctt
agtgaaaatccaccaccatgctttcaaatatgtttcttctatgcaccgttcaaacagatg
gtccacagttccgacaaagtggcagatgaggcagaacgtggaaaacttaacggagagatt
acttccatgattgccgatgatctgatcgaacaaggatttatggttgactatgcaccacca
gctgcagcccaagttgaaggagacggcaaatatcttagatgtgtcatcaatcttcacact
aagaaagaaacagtcgagcgactcgtcgaagtagtcttgcaattgggtgccaaagcggtc
aggaagcagcgtggactcgagttgaacgggacctttgtaaatccgaaccaggctccagca
cctggccagcgaccaaagcaccctcttgagatgggtcgtgggcctcaaggcgctccggct
gcctcggatttcgtgctttga

DBGET integrated database retrieval system