KEGG   Acinetobacter baumannii AB0057: AB57_1335Help
Entry
AB57_1335         CDS       T00793                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
abn00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:abn00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AB57_1335
Enzymes [BR:abn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AB57_1335
Transporters [BR:abn02000]
 Other Transporters
  Pores ion channels [TC:1]
   AB57_1335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C GST_C_3 GST_N_3 GST_N_2 GST_C_2
Motif
Other DBs
NCBI-ProteinID: ACJ40355
LinkDB All DBs
Position
1421822..1422433
Genome map
AA seq 203 aa AA seqDB search
MKLYYSPGACSLAAHIILNEINVDFDLERVNLKTHKTEKGTDYYEINPKGYVPALEINPG
LILTENVAILPFLAQHDPKQDLIPPSGLGRAKVLEWLGYLNSELHDAYAVFFGAPLTNDE
KTKAYAEIDRLLKYIDNYLAESDYDYLVNDNFGPADAYLFVLTNWSNSIEHDLTPYKHII
ALRNKVAERQSVQIAMRDEGLIS
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatattattcgccaggcgcatgttctttagctgcacatattattttaaatgaa
attaatgttgattttgatttagaacgagtaaatttaaaaacacataaaacagaaaaaggt
acagattattatgaaattaacccaaagggatatgtaccagctttagaaattaatccggga
ttaattttaactgaaaacgtagcgattttacctttccttgctcagcacgaccctaaacaa
gatttgattcctccttcgggcttaggccgtgcgaaagtattggaatggttgggctattta
aattctgaattgcatgatgcatacgcggtattttttggggcaccgttaacaaatgatgaa
aaaaccaaagcttatgctgaaatcgaccgtcttttaaaatatatcgataattatttggct
gagtcggattatgactatttggtaaatgataattttggtccagcagatgcgtatttattt
gttttaacaaattggtcaaactcaattgagcatgatttaacgccatataaacatattatt
gccttacgtaataaagttgcagaacgtcaatctgtacaaattgcaatgcgtgatgaaggc
ttaatttcataa

DBGET integrated database retrieval system