KEGG   Agaricus bisporus var. burnettii JB137-S8: AGABI1DRAFT77702Help
Entry
AGABI1DRAFT77702  CDS       T03136                                 

Gene name
AGABI1DRAFT_77702
Definition
(RefSeq) hypothetical protein
  KO
K00693  
glycogen synthase [EC:2.4.1.11]
Organism
abp  Agaricus bisporus var. burnettii JB137-S8
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AGABI1DRAFT77702 (AGABI1DRAFT_77702)
Enzymes [BR:abp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     AGABI1DRAFT77702 (AGABI1DRAFT_77702)
Glycosyltransferases [BR:abp01003]
 Polysaccharide
  Storage polysaccharide
   AGABI1DRAFT77702 (AGABI1DRAFT_77702)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 759 aa AA seqDB search
MAAESKRDVRQPVLFECAWEVANKVGGIYTVIKTKVPVSVSEFGDRYCLIGPLSYKTAPM
EVEPEEPSDPHLAATLQSMQAQGVKALYGRWLIEGNPQVLLFDTSSMYPRLDEWKADLWN
LAGIPSPPNDHETNETIVFGYLVAWFLGDYVSRQLTTAIVAHFHEWQAGLAIPLCRKRHI
DVTTVFTTHATLLGRYLCAGSVDFYNNLQYFDVDHEAGKRGIYHRYCIERSAAHCADVFT
TVSHITAYESEHLLKRKPDGVLPNGLNVVKFQAMHEFQNLHATAKAKINEFIRGHFYGHY
DFDLDNTIYLFTAGRYEYRNKGVDMFIESLARLNYQLQKAGSTVTVVAFIIMPAATHSYT
IDALKGQAVTKQLRDTVTEIQNRIGQRLFDRAARFTGDMKSIPTADDLISEEDQILLKRR
IFALKRNSLPPVTTHNMADDPNDPILNQIRRVKLFNNAHDRVKIIFHPDFLNSNNPILAL
DYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSITTNLSGFGCFMQDLIERPEEEGCY
IVDRRMQSVEDSVNQLADYLYAFTNKTRRQRINQRNRVERLSPLLDWKNLGIEYSKARQL
GLRRAYPDAFEGGEGVVGGGPGGHGGHGGGGRRVGMYASAGSVPASPRMRGAITPGDIGT
LTEDMQGLGTSDYRGYGWADHVDEDDTYPFPLAMKVRSRSGSVRSRSGASTPGGGGVGAF
KSLSEGDLRKANAALKLSQVNGEDEDTGGKNGGEGGSGN
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgaaagcaagcgcgatgtccgacagcccgtcctgttcgaatgtgcgtgggaa
gtcgcgaacaaggtcggggggatctacacggtgatcaagaccaaagtgcccgtctctgtc
tccgagtttggcgaccgatactgcctcatcgggccgctctcctacaagaccgcgccgatg
gaggtcgagccagaggagcccagtgacccccatctcgctgccactctccagtccatgcag
gcccagggcgtcaaggctctctacggtcgctggctcatcgagggcaacccccaggtcctt
ctctttgataccagcagcatgtacccccgcctcgacgagtggaaggccgacctctggaac
ctcgctggtatccccagccctcccaacgaccacgagacaaacgagaccatcgtctttggc
tatctcgtcgcttggttcctgggcgattacgtctcccgccaactgaccaccgccatcgtc
gcccactttcacgaatggcaagccggcctcgccatccccctctgtcgcaaacgtcatatc
gatgtcaccacggtgttcaccacccatgccaccctcttgggccgatatctctgtgctggc
tctgtcgacttttacaacaatctccaatactttgacgtcgaccacgaggccggaaaacgc
ggtatctaccacagatactgcatcgaacgttctgctgcccactgcgccgacgtctttacc
accgtttctcacatcacagcctacgaaagcgagcatctcctcaaacgcaaacccgacggt
gtccttcccaacggtctcaacgtcgtcaaatttcaagccatgcacgaatttcaaaacctt
catgccaccgccaaggccaagatcaacgagtttatccgtggtcatttctatggccactac
gactttgatcttgataataccatctacttgtttactgccggtcgttacgagtacaggaac
aagggcgtggacatgtttattgaatctctcgctcgcctcaactatcagttgcagaaagca
ggctcaacagtcactgtcgtcgcctttatcatcatgcccgccgcgacccactcttatacc
atcgatgctctcaaaggacaagccgtcacaaagcagctccgcgatacagtcaccgaaatc
caaaatcgtatcggtcaacgtttgtttgaccgtgccgcccgtttcactggcgacatgaaa
tccattccaactgcagatgatttgatttcagaagaagatcaaattctactcaagcgacgt
atctttgcgcttaagcgaaactcacttccacctgtcacgacgcacaacatggctgatgat
cccaacgatccgattttaaaccagatccgacgtgtcaagttgttcaacaatgctcatgat
cgtgttaaaatcatctttcatcctgattttctcaatagtaataatccgattttggcattg
gattatgaagagtttgtgaggggatgtcatttgggtgtgtttccgagttattatgaaccg
tgggggtatacacctgcggaatgtactgttatgggaattccgagtattacgaccaacctt
tctggatttgggtgttttatgcaagatcttattgaacgtcctgaagaagaaggctgttac
attgtcgatcgtcgaatgcaatccgtcgaagattcagttaaccaattagccgattatctg
tatgcgtttacaaacaaaactcggcgtcaaaggatcaatcaacgtaatcgagtcgaacgg
ttgtcgccgttgttggattggaagaatttggggattgagtattcaaaggccaggcaattg
gggttgaggagagcttatccggatgcgtttgagggtggggagggtgtggtgggtggtggg
ccggggggacatgggggacatggaggtggggggaggagggtgggtatgtatgctagtgcg
gggagtgtacctgctagtccgaggatgagaggtgcgattaccccaggtgatattgggact
ttgacggaggatatgcaaggtctggggacgagtgattatagagggtatggatgggccgat
cacgtagacgaagatgatacctatcccttccccctcgcaatgaaagtccgttcgagatca
ggttcggtgagaagtcgaagtggggcaagtacacctggtgggggaggggtgggagcgttt
aagagtttgagtgagggggatttgagaaaggcgaatgcggctttgaagttgagtcaggtg
aatggggaggatgaggatacgggtgggaagaatgggggtgaaggtgggagtgggaattga

DBGET integrated database retrieval system