KEGG   Azospirillum brasilense Az39: ABAZ39_02780Help
Entry
ABAZ39_02780      CDS       T03288                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
abq  Azospirillum brasilense Az39
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:abq00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    ABAZ39_02780
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ABAZ39_02780
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    ABAZ39_02780
Enzymes [BR:abq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ABAZ39_02780
Peptidoglycan biosynthesis and degradation proteins [BR:abq01011]
 Precursor biosynthesis
  Amino acid ligase
   ABAZ39_02780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(584306..585256)
Genome map
AA seq 316 aa AA seqDB search
MTTPHKKHVAVLMGGWSAEREVSLVSGAGVAKALEEEGYRVTAVDVQRDLEGLLRALTDP
RPDAVFNALHGRGGEDGTIQGVLEFLGIPYTHSGVRAAAVAMDKAMTKALLAPVGVRSPK
GLVLTKGELTGGAHPMPAPYIVKPVDEGSTVGVTLVREGQNSPVGDAWTFGERALVEEFI
PGRELTVGVMGGLDGECRPLTVTEIRFEAQVYDYTAKYSAGHAVHTVPAQIPDHVAEEAK
RLAVLAHRTLGCRGVSRSDFRWDDRKSGTDGLFFLEINNQPGMTPLSLVPEQAAAVGLSY
GALVAWMVENAACQLD
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccccccacaagaagcatgtcgccgtcctgatgggcggctggtcggcggagcgc
gaggtgtcgctggtcagcggcgccggcgtcgccaaggcgctggaggaggaaggctaccgc
gtcaccgcggtggacgtgcagcgcgacctggaggggttgctgcgcgcgctgaccgatccg
cgccccgacgcggtgttcaacgccctgcacgggcgcggcggcgaggacgggaccatccag
ggcgtgctggaattcctcggcattccctacacccattccggcgtgcgcgccgccgccgtc
gccatggacaaggcgatgacgaaggcgctgctcgccccggtcggcgtgcgctcgcccaag
ggcctcgtcctgaccaagggcgagctgaccggcggcgcccacccgatgcccgccccctac
atcgtcaagccggtggacgagggttcgacggtcggggtcacgctggtgcgcgaggggcag
aacagcccggtcggcgacgcctggaccttcggcgagcgcgccctggtcgaggagttcatc
ccgggccgcgagttgaccgtgggcgtcatgggcgggctggacggcgagtgccgccccctg
accgtgacggagatccgcttcgaagcacaggtgtatgactacacggctaaatacagcgcg
ggccatgccgttcatactgtgcccgcgcagattcccgaccacgtcgcggaagaagccaag
aggttggcggtcctggcccaccggaccctggggtgccgcggcgtttcgcgcagcgacttc
cgctgggatgatcgtaaaagtgggaccgacggactctttttcctggaaatcaacaaccag
ccgggcatgacgccgctgtcgctggttcccgaacaggccgctgccgtggggctctcctac
ggggctctcgtcgcttggatggtggagaacgccgcatgtcaactcgactga

DBGET integrated database retrieval system