KEGG   Azospirillum brasilense Az39: ABAZ39_05185Help
Entry
ABAZ39_05185      CDS       T03288                                 

Definition
(GenBank) alpha-amylase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
abq  Azospirillum brasilense Az39
Pathway
abq00500  Starch and sucrose metabolism
abq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abq00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ABAZ39_05185
Enzymes [BR:abq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     ABAZ39_05185
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     ABAZ39_05185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C APH DUF3459
Motif
Other DBs
NCBI-ProteinID: AIB11415
UniProt: A0A060DFF6
LinkDB All DBs
Position
1075386..1078685
Genome map
AA seq 1099 aa AA seqDB search
MDRNDTLWYKDAVIYQLHVKAFFDADNDGIGDIAGLTQKLDYIQELGVTTLWLLPFYPSP
LRDDGYDIADYKAVNPSYGNLQDFKRFLRECHDRGLRVITELVINHTSDQHPWFQRARQA
KPGSNHRNFYVWSDTDQKYQGTRIIFCDTEKSNWTWDSEAQAYFWHRFYSHQPDLNFDNP
KVLQEVLNVMRFWLDMGVDGLRLDAVPYLKEREGTNNENLPETHDVLKAIRTEIDKGYGD
RMLLAEANQWPEDVLPYFGDLEKGGDECHMAFHFPLMPRIYMAVAMEDRHPIADIMRQTP
DIPDECQWAIFLRNHDELTLEMVTDRERDYLWDFYAADRRMRINLGIRRRLAPLLQNDRR
KIELLKSLLLSMPGTPVLYYGDEIGMGDNIYLGDRDGVRTPMQWSPDRNGGFSRADPARL
YLPAIQDPIYGFQAINVEAQQRSPSSLLNWMKRLIAVRQQHKAFGRGRFQLLYPGNRKVL
AYLRCHSTEEGDEVILCVANLSRSAQAVELDLKQFRGRVPVEMLGRTVFPPVGDLPYLLT
IPAYGFYWFALAAEAALPSWHETMPEPVPDLLTIVVRDGWHSLISGRAGEELARDILQAY
LPQQRWFAAKDRRIESAHIPMFARLNGPGDGFMMVRADVSLTGAKPQSYFLPLAMSWEEN
AGNTGWPLLPFTLAKARRGPRTGAIYDAMQADAFTRSLLTALREGREVPASSGHLRFSPT
ACMADLSVDDDTEIRRLGVEQSNSSILVGSQAVLKAFRRLTPGAHPELEVGRFLTEVAGF
QNTPPLLGSVEHVAEDGTPTALFVLQGYVRNQGDGWSSTVDSLVRDLDDIRLGLSHDPEE
PTEGEPFGMHAAMMATLGQRTAELHCALAKRTGDPAFDPEPVTADDLKGWGEAARRQAEA
AFAALPGALDRLAPAVREQAESLLARRTDVMNRLAELADTPPQGDKTRIHGDYHLGQVLR
AQNDWYIIDFEGEPAKSLEERRAKHSPLRDVAGMLRSFNYATWAALFRIDETGVLEEAGA
VMEAALDWERRSMQSFLEAYRAAMGACPDVPDGTAGDRRLLALFLMEKALYEIAYEAANR
PNWIGIPVKGVLGLLDGES
NT seq 3300 nt NT seq  +upstreamnt  +downstreamnt
atcgatcggaacgacacgctctggtacaaggacgcggtcatctatcagcttcacgtcaag
gcgttcttcgacgccgacaatgacggcatcggcgacatcgccggcctgacgcagaagctc
gactacatccaggagcttggcgtcaccacgctgtggctgctgcccttctacccctcgccg
ctgcgcgacgacggctacgacatcgccgactacaaggcggtcaacccgtcctacggcaat
ctccaggacttcaagcggttcctgcgcgagtgccacgaccgcggcctgcgtgtcatcacg
gaactggtcatcaaccacacctccgaccagcacccgtggttccagcgcgcccgtcaggcc
aagccgggttccaaccaccgcaatttctacgtctggtccgacaccgaccagaagtaccag
ggcacccgcatcatcttctgcgacacggaaaagtccaactggacctgggattccgaggcg
caggcctatttctggcaccgcttctattcgcaccagcccgacctgaacttcgacaacccg
aaggttcttcaggaggtgctgaacgtcatgcgcttctggctggacatgggggtggacggg
ctgcggctcgacgccgtgccctacctgaaggagcgcgagggcaccaacaacgagaacctg
ccggaaacccacgacgtcctgaaggcgatccgcaccgagatcgacaagggctacggcgac
cgcatgctgctggccgaagcgaaccagtggccggaggacgtgctcccctatttcggcgac
ctggagaagggcggggacgaatgccacatggccttccacttcccgctgatgccgcgtatc
tacatggccgtcgccatggaggaccggcaccccatcgccgacatcatgcgccagactccg
gacatcccggacgaatgtcagtgggccatcttcctgcgcaaccatgacgagctgacgctg
gagatggtgaccgaccgggagcgcgattatctctgggacttctacgccgccgaccggcgc
atgcggatcaacctgggcatccggcggcgcctcgccccgctgctccagaacgaccgccgc
aagatcgagctgttgaagagcctgctgctgtccatgccgggcacgccggtgctctattac
ggcgacgagatcggcatgggtgacaacatctatctcggcgaccgcgacggcgtgcgcacg
ccgatgcagtggtcgcccgaccgcaacggcggcttctcccgcgccgacccggctcggctg
tatctgccggcgatccaggacccgatctacggcttccaggccatcaacgtggaggcgcag
cagcgcagcccgtcgtctctgctgaactggatgaagcggctgatcgcggtgcgccagcag
cacaaggccttcgggcgcggccgtttccaactcctctatccgggcaaccgcaaggtcctg
gcctatctgcgctgccattcgacggaggagggcgacgaggtcatcctctgcgtggccaac
ctgtcccgctccgcccaggcggtcgaactggacctgaagcagttccgcgggcgcgtgccg
gtggagatgctgggccggacggtcttcccgccggtcggcgatttgccctacttgctgacc
atccctgcttacggcttctactggttcgcgctggccgccgaggcggctctgccctcctgg
cacgagacgatgccggagccggtgcccgacctgctgaccattgtcgtgcgcgacggctgg
cacagcctgatcagcggccgcgccggcgaggaactggcacgcgacatcctgcaggcctac
ctgccgcagcagcgctggttcgccgccaaggaccgccggatcgagagcgcgcacatcccg
atgttcgcgcggctcaacgggccgggcgacggcttcatgatggtgcgggccgacgtctcc
ctgaccggagccaagccgcagtcctacttcctgccgctcgccatgagctgggaggagaac
gccggcaacaccggctggccgctgctgcccttcacgctggccaaggcccggcgcggtccg
cggaccggcgccatctacgacgccatgcaggccgacgccttcacccgcagcctgctgacc
gccctgcgcgaggggcgggaggttccggcgtcgagcgggcacctgcgcttctcgcccacg
gcctgcatggccgacctgtcggtggacgacgacaccgaaatccgccgcctcggcgtggag
cagagcaacagctccatcctcgtcggcagccaggccgtgctgaaggcgttccgccgcctg
acccccggcgcccatccggaactggaggtcgggcgctttctgaccgaggtggcgggcttc
cagaacacgccgccgctgctcggttccgtcgagcatgtggcggaggacggcacgccgacc
gcgctgttcgttctccagggctatgtccgcaaccagggcgacggctggagcagcaccgtc
gattcgctggtgcgcgatcttgacgacatccgtctcggcctgtcccacgacccggaggag
cccactgagggcgaacccttcggcatgcacgccgccatgatggcgacactcggccagcgc
accgcggaactccattgcgcgctggcgaagcggaccggcgatccggccttcgatccggag
ccggtcaccgccgacgacctgaagggctggggcgaggccgcccgccgtcaggccgaggcc
gccttcgccgcgctgcccggcgccttggaccgtctggcccccgccgtgcgcgagcaggcg
gaatcgctgctggcccgccgcactgacgtgatgaaccggctggccgagctggcggacacg
ccaccgcagggcgacaagacgcgcatccacggcgactatcacctggggcaggtgctgcgt
gcccagaacgactggtacatcatcgacttcgagggcgagccggcgaagtccctggaggag
cgccgggccaagcacagcccgctgcgggacgtggcggggatgctgcgctccttcaactac
gccacctgggcagcgctgttccggatcgacgagacgggcgtgctggaggaggccggtgcc
gtgatggaggcggcgcttgattgggaacggcgcagcatgcagagcttcctggaggcctac
cgcgccgccatgggggcctgcccggacgtgccggacggaaccgccggtgaccgccgtctc
ctcgcgcttttcctgatggagaaggcgttgtacgagatcgcctacgaggccgccaaccgg
cccaactggatcggcattccggtgaagggcgtgctggggcttctggacggcgagtcctga

DBGET integrated database retrieval system