Azospirillum baldaniorum Sp245: AZOBR_110108 Help Entry AZOBR_110108      CDS       T02152                                  Symbol acpP2 Name (GenBank) acyl carrier protein (ACP)   KO K02078   acyl carrier protein Organism abs  Azospirillum baldaniorum Sp245 Pathway abs01100   Metabolic pathways abs01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:abs00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AZOBR_110108 (acpP2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AZOBR_110108 (acpP2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  CCC98134 UniProt:  A0A9P1JR29 LinkDB All DBs Position 1763814..1764053 Genome browser AA seq 79 aa AA seqDB search MSDVAERVKKIVVDHLGVEESKVTENASFIDDLGADSLDTVELVMAFEEEFGCEIPDDAA EKILTVKDAIDFIKANAAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatgtcgccgagcgcgttaagaagatcgttgtggaccacctcggggtcgaggag tcgaaggtgacggagaacgcctccttcatcgacgatctcggcgccgacagcctcgacacg gtcgagctggttatggctttcgaggaagagttcggctgcgagattccggacgacgccgcc gagaagattctgacggtgaaggacgccatcgacttcatcaaggcgaacgccgcggcctga

DBGET integrated database retrieval system