KEGG   Azospirillum brasilense Sp245: AZOBR_p210197Help
Entry
AZOBR_p210197     CDS       T02152                                 

Definition
(GenBank) uncharacterized ribulose bisphosphate carboxylase-like protein (modular protein)
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
abs  Azospirillum brasilense Sp245
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:abs00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AZOBR_p210197
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AZOBR_p210197
Enzymes [BR:abs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     AZOBR_p210197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
AZOBR_p2:194023..195843
Genome map
AA seq 606 aa AA seqDB search
MSRFFGQIRQAGYVVDDIEAAMDYWSRTLGIGPWFYNERVPIRNYTYRGERYEVHNSVAL
ANSGPLQMELIQTRNDAPSMYRDFLKAGRTGLQHVAYWTENYDADLERLTGQGFKPVMSG
EVGEKGRFVYFDTEYHPRYGDRAVGGRRAEGQDVRPDPQRLPRLGRPRSGPALPRPQPAV
SPAMRSDRFEATYLIETPLDPAKVAEVMAGEQSCGTFTRVHGETDDLRARARAVVERVEE
LEPAASPSLPNTWLERQKRPGPWRRARVAISFPTGNVGANLPTLAATVAGNLFDLGEVTG
LRLDSVRLPAAYRKGFDTPRHGVAGTRRVTGVERGALVGSIIKPNLGLSAEETGELVGTL
CAAGLDFIKDDEICADPIHAPLAQRVPAVMDRVRRHQDRTGKHVMVAFNISDETDAMRRH
ADLVEREGGSCVMVSLNWCGFSAVQTLRRHSGLVLHGHRNGFGALSRHPSLGIGFDAYQT
LWRLAGVDHMHVHGLQGKFAQPDAEVIDGAKSCLAPLAEGCDDTVMPAFSSGQWAGTVPV
TWDAVGTDDLLFMSGGGIMAHPDGPAAGVTSIRQAWEAVREGVTLPDAAATRPELKRALE
FFGAGK
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgagccgattcttcggccagatccggcaggctggctacgtcgtcgacgacatcgaggcc
gccatggactactggagccgcaccctgggcatcggcccgtggttctacaacgagcgggtt
ccgatccggaactacacctaccgcggggagcggtacgaggttcacaactcggtggcgctc
gccaactccggcccgctccagatggagctgatccagacccgcaacgacgcgccgtcgatg
taccgcgacttcctgaaggcgggccgcaccggcctccagcacgtcgcctactggaccgag
aattacgacgccgacctggagcgactgaccggccagggcttcaagccggtgatgagcggc
gaagtcggcgagaagggccgcttcgtctatttcgacaccgaataccacccccggtacggt
gatcgagctgtcggaggtcgccgggccgaagggcaagatgttcgacctgatccgcaacgc
ctccctcgactgggacggccgcgatccggtccggcccttccccgacctcagccggctgtg
agtcccgccatgcgctccgaccgcttcgaggcgacctatctgatcgagaccccgctggat
cccgccaaggtggcggaggtcatggcgggggagcagtcctgcggcaccttcacccgcgtc
cacggcgagacggacgacctgcgcgcccgcgcccgcgccgtggtggagcgggtggaggag
ttggaacccgccgcctcccccagcctgccgaacacatggctggagcggcagaagcggccc
ggaccgtggcggcgcgcccgcgtcgccatcagcttccccaccggcaacgtcggcgccaac
ctgccgacgctggccgcgacggtggccggcaacctgttcgatctcggcgaggtcaccggc
ctgcggctcgactccgtccgcctgcccgccgcgtaccgcaagggcttcgacacgccgcgg
cacggcgtggccggcacgcggcgggtgaccggggtggagcgcggggcgctggtcggctcc
atcatcaagccgaacctcggcctgtcggcggaggagaccggcgagttggtcggcacgctc
tgcgccgccgggctggacttcatcaaggacgacgagatctgcgccgatccgatccacgcc
ccgctggcccagcgcgtgccggcggtgatggaccgggtacgccgccaccaggaccgcacc
ggcaagcacgtcatggtcgccttcaacatcagcgacgagacggacgccatgcgccgccat
gccgatctggtggagcgcgagggcggaagctgcgtgatggtcagcctgaactggtgcggc
ttctccgccgtgcagacgctgcgccgccacagcgggctggtgctgcacgggcaccgcaac
ggcttcggcgccctgtcgcgccaccccagcctgggcatcggcttcgacgcctaccagacg
ctgtggcggctcgccggggtggaccacatgcacgtccacggcctccagggcaagttcgcc
cagcccgacgcggaggtcatcgacggcgccaagtcctgcctcgccccgctggccgaaggc
tgcgacgatacggtgatgccggccttctcctccggccagtgggcgggaaccgttcccgtc
acctgggacgcggtggggacggacgacctgctgttcatgtccggcggcggcatcatggcc
catccggacggccccgccgccggcgtgacgagcatccgtcaggcctgggaggcggtgcgc
gagggcgtcaccctgcccgacgccgccgcgacccggccggagttgaagcgtgccctggag
ttcttcggagcgggcaagtga

DBGET integrated database retrieval system