KEGG   Agaricus bisporus var. bisporus H97: AGABI2DRAFT194531Help
Entry
AGABI2DRAFT194531 CDS       T03140                                 

Gene name
AGABI2DRAFT_194531
Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
abv  Agaricus bisporus var. bisporus H97
Pathway
abv00250  Alanine, aspartate and glutamate metabolism
abv00410  beta-Alanine metabolism
abv00430  Taurine and hypotaurine metabolism
abv00650  Butanoate metabolism
abv01100  Metabolic pathways
abv01110  Biosynthesis of secondary metabolites
Module
abv_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:abv00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    AGABI2DRAFT194531 (AGABI2DRAFT_194531)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AGABI2DRAFT194531 (AGABI2DRAFT_194531)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AGABI2DRAFT194531 (AGABI2DRAFT_194531)
   00430 Taurine and hypotaurine metabolism
    AGABI2DRAFT194531 (AGABI2DRAFT_194531)
Enzymes [BR:abv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AGABI2DRAFT194531 (AGABI2DRAFT_194531)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC dCache_3 OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 18082895
NCBI-ProteinID: XP_006463840
JGI: Agabi_varbisH97_2_194531
LinkDB All DBs
Position
Unknown
AA seq 533 aa AA seqDB search
MSLSRHINAEEIIEKSKDHPQIKFANAARRHGPANTSHWNRDEDVAGLSKYTIPPKGVSS
RSAYQLLHDEMALDGNPTLNLASFVHTYMPEEAKKLMVENISKNIVDQEEYPAAQLIHNR
CISMIADLWKAPKDAKPIGTATAGSSEAIMLGGLAMKKRWQEARKAAGKDYFHPNIVFGS
NAQVALEKFARYFDVECRLVPVTEEHDFVMNPHDALQYIDENTIGVMVILGSTYTGHFEN
VQLMSDLLDNLQQRTGLDIPIHVDAASGGFFAPFAYPHLKWSFEIPRVVSINASGHKFGL
VYVGIGWVLWRDESLLHKDLIFELHYLGSTEYSFTLNFSKPAAPIIGQMFNFLNLGVDGF
KRIAVKDLRNARMLSRALNGTYFKVLSSIHLPVHEDRGDDVPEHYRSGLPVVSFRLSDEF
KAANPQVEQKWIQTLLKTKGWIVPNYNAPEGTEDVEILRVVVRESVSEDLVERLIVDIVE
ITESLQGSEGNLMATTSNSAVHHPEKHHGRPDPENFGKSHKPAKKQAGFSRQC
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgtctctttctagacacatcaacgccgaagaaatcattgaaaagtctaaggatcatcct
cagataaagtttgctaacgcagctagacgtcatggccctgccaatacctctcattggaat
cgcgacgaggatgttgcgggactctccaagtataccattcccccgaaaggagtctcatct
agatcagcataccaacttctccacgacgagatggctctggacggtaacccaactctgaac
ttggcgtccttcgtacacacatatatgcctgaggaggctaaaaagttgatggttgagaac
atcagcaaaaacatagttgatcaagaggaatacccggccgctcaactaattcacaaccgc
tgcatttcaatgattgcggatctgtggaaggcaccgaaggacgccaagcccatcggaacg
gctactgctggctcttcggaagccataatgctaggtggattggctatgaaaaaacgttgg
caagaagcgcgtaaggctgctggaaaggactacttccatcccaacatcgtattcggttcg
aacgctcaagttgctcttgagaaattcgcacggtacttcgacgtcgaatgtcgtttggtt
ccagtcacagaagaacatgatttcgttatgaatcctcacgatgctttgcaatacattgat
gagaataccatcggtgtcatggtcattcttggaagcacctacactggccacttcgaaaat
gtccaactcatgagcgacctattggacaatcttcagcagcgtactggccttgatattcct
attcatgttgatgctgcttctggtggattctttgcgcctttcgcttatccgcacctcaaa
tggtctttcgaaattccgcgagtagtttctattaacgcctctggtcataaatttggtctg
gtttatgtcggaatcggctgggttctctggcgcgatgagagcttattgcataaagatttg
atttttgaacttcattaccttggtagcacggaatactcatttactctgaacttctccaaa
ccggccgctccgattattggacagatgttcaatttcctgaatcttggagttgatggcttc
aaacgaattgctgtcaaggacctgcgtaacgcgagaatgctatctcgtgcactaaatgga
acctatttcaaagtcttgagcagcattcatctaccagttcatgaggaccgtggagacgac
gttccggagcactacagatccggcctgcctgtggtttcctttagattgtctgatgagttc
aaagcagcaaatcctcaagtagagcaaaagtggatccagactttactgaaaactaaggga
tggatcgttcctaactacaacgctcccgaaggcacagaagatgttgagatcttgcgcgtc
gttgtccgcgaaagtgtaagcgaggacttggtcgagcgccttattgtagatatcgttgaa
atcactgaatcacttcaaggctcggagggtaatctgatggcgacgacatccaattcggcc
gttcaccatcccgagaagcaccatggccgacccgatcccgaaaacttcggcaagtctcac
aaacctgccaagaagcaagctggtttctccaggcaatgttga

DBGET integrated database retrieval system