KEGG   Agaricus bisporus var. bisporus H97: AGABI2DRAFT204991Help
Entry
AGABI2DRAFT204991 CDS       T03140                                 

Gene name
AGABI2DRAFT_204991
Definition
(RefSeq) hypothetical protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
abv  Agaricus bisporus var. bisporus H97
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:abv00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AGABI2DRAFT204991 (AGABI2DRAFT_204991)
Enzymes [BR:abv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AGABI2DRAFT204991 (AGABI2DRAFT_204991)
Transporters [BR:abv02000]
 Other Transporters
  Pores ion channels [TC:1]
   AGABI2DRAFT204991 (AGABI2DRAFT_204991)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
LinkDB All DBs
Position
Unknown
AA seq 256 aa AA seqDB search
MSIPDAQIHPVATGAASETVAKHQDPQEITLWSGWFCPFVQRIWIALEERGIPYQYKEVN
PYKKEKHFLDINPKGLVPAVEYKGKALYESLVLLEFLEEAYPTVKPSLLPAEPYDRAVAR
IWVDHITKNYLPAFHRLVQSQEPEVQEQARNDLIEAQKKLVAQVKGPYFFGEQFGIVDIA
VAPWIVRDWVISENRGYSRSQAGEAWTKYAKAVTERPSLLKTESDKEHYGQIYGRYLRNE
AQSEAAKAIRAGKQIP
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcccagacgcacaaatccatcccgtagcgacgggtgctgcgagtgagacggta
gcaaaacatcaggatcctcaagaaattacactctggtctggttggttttgtcccttcgtc
caaaggatttggatcgctctcgaggagaggggaattccgtaccagtacaaagaagtcaat
ccttataagaaggagaaacatttccttgatatcaaccccaaaggtctcgtacccgctgtc
gaatacaagggaaaggcattgtatgagtcactcgtccttctggaattcttagaggaagcc
tatcctacggtcaagcccagtctgctcccggcggaaccatacgatcgggctgtggctcga
atttgggtggatcatatcaccaagaattaccttccggcattccatcgacttgtgcaatcg
caagaaccggaagttcaagaacaggcacgcaacgatttaattgaggctcaaaagaagctg
gtggcacaagttaaaggcccatacttctttggggagcaatttggaatcgttgacattgct
gtggcgccttggattgtaagagattgggttatcagcgagaacagaggatatagtaggagt
caagctggagaagcttggacgaaatatgccaaggcggtaactgagagaccaagtctgttg
aagacggagagcgataaggaacattatggtcagatatatgggcgttatctaaggaatgaa
gctcagagtgaggctgcaaaggcaataagagccggaaagcagatcccttaa

DBGET integrated database retrieval system