KEGG   Acinetobacter baumannii AYE: ABAYE1460Help
Entry
ABAYE1460         CDS       T00667                                 

Gene name
ald1
Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  
aldehyde dehydrogenase [EC:1.2.1.-]
Organism
aby  Acinetobacter baumannii AYE
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aby00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABAYE1460 (ald1)
   00620 Pyruvate metabolism
    ABAYE1460 (ald1)
Enzymes [BR:aby01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     ABAYE1460 (ald1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1523294..1524805)
Genome map
AA seq 503 aa AA seqDB search
MRYIDPNQPGSKVQFKSQYENFIGGEWVAPLKGEYFDNVSPVDGKAFTRIPRSSAEDIEL
ALDAAHKAKASWNKSSPTTRSNILLKIADRLEANLEMLAVAETWDNGKAVRETLAADLPL
AIDHFRYFAGCIRAQEGGISEIDEDTIAYHFHEPLGVVGQIIPWNFPILMAAWKLAPALA
AGNCVVIKPAEQTPVGILLVAELIQDILPPGVLNIVNGFGAEVGRPLATSPRIAKIAFTG
STQTGQMVMQYATENIIPVTLELGGKSPNLFFEDIMDKEDDFLEKTLEGFAMFALNQGEV
CTCPSRALVQESIANQFLELAVERVKRIKTGHPLDTETMIGAQASLQQQEKILRCINTGR
EEGAELLLGGSGRKEVGDGFYVDPTIFKGHNSMQVFQEEIFGPVLAVTTFKDFDDAIKIA
NDTMYGLGAGVWSRSAHISYRAGRAIEAGRVWTNCYNIYPAHAAFGGYKKSGIGRENHKM
MLDHYQQTKNLLVSYSTKPMGFF
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatatcgatccaaatcaaccaggctcaaaagttcaatttaaatcacaatatgaa
aattttattggcggtgaatgggttgcacctctaaagggtgaatattttgataatgtgtca
ccagtggatggaaaagctttcacacgcattccacgctctagtgctgaagatattgaactt
gctttagatgcagcacacaaagcgaaagcttcatggaataaatcttcaccgactacacgt
tctaatatacttttaaaaattgctgatcgtttagaagcaaatcttgaaatgcttgcggtt
gcagaaacttgggacaacggtaaagcagttcgtgaaactttagcagctgaccttccactt
gcaatcgaccatttccgttatttcgcaggatgtattcgtgctcaagaaggcggcatctct
gaaattgatgaagataccattgcctaccatttccatgaaccactaggtgtggttggtcaa
atcattccatggaacttcccgattttaatggctgcatggaagctcgctcccgctttggcg
gctggtaactgtgtggtgattaagccagctgagcaaactccggtaggtattttgttggtt
gccgaactcatccaagatatcttaccgccgggcgtacttaatattgtgaatggtttcggt
gcagaagttggccgtccgttagcgacaagcccacgtattgcaaaaattgcgttcacaggt
tcaactcaaactgggcaaatggtgatgcaatatgcgaccgaaaatattattccagtcacg
ctagagcttggcggcaagtcaccgaaccttttctttgaagacatcatggataaagaagat
gacttcttagaaaaaacgctggaaggttttgccatgtttgccttaaaccaaggtgaagta
tgtacttgcccttctcgtgctttagtacaagaaagtattgctaatcaattcttagagttg
gccgtcgaacgtgtaaaacgtattaaaactggtcatcctctcgatactgaaaccatgatt
ggtgctcaagcatctttgcaacaacaagagaaaatcttacgttgtattaatacgggccga
gaagaaggtgcagaactcttacttggtggtagtggccgtaaagaagtaggtgatggtttc
tatgttgatccgactatttttaaaggccacaacagcatgcaagttttccaagaagaaatt
tttggtcctgtactggctgtgacaacatttaaagactttgacgatgcaatcaaaattgcc
aacgacactatgtatggtttaggtgcaggtgtatggtcacgttcagcccatatttcttac
cgtgctggtcgtgctattgaggcgggtcgtgtctggacaaactgctataacatctaccct
gctcatgctgcatttggtggctacaagaagtctggtattggtcgtgaaaaccataagatg
atgctagatcactatcaacaaaccaaaaacttgttggtgagttattcaaccaaaccaatg
ggcttcttctaa

DBGET integrated database retrieval system