KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_00125Help
Entry
ABZJ_00125        CDS       T01820                                 

Definition
(GenBank) alanine racemase 2, PLP-binding, catabolic
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:abz00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    ABZJ_00125
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    ABZJ_00125
Enzymes [BR:abz01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     ABZJ_00125
Peptidoglycan biosynthesis and degradation proteins [BR:abz01011]
 Precursor biosynthesis
  Racemase
   ABZJ_00125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
139350..140453
Genome map
AA seq 367 aa AA seqDB search
MPRPITAVIHRQALQNNLAVVRKAMPNSKVFAVVKANAYGHGIERVYEAFKAADGFALLD
IEEAKRIRALGWTGPILLLEGVFSPQDLFDCVQYQLSFTIHSEAQIEWVEQHPYPAQFDV
FLKMNSGMNRLGFKPQHYVQAWERLNNLANVAKITHMMHFSDADGDRFGQQGIDYQITAF
EEIVKDLPGERSVSNSAAILRYQDQLKSDYVRSGIMLYGSSPDYPTHSIADWGLQPTMSL
RSEIISVQHLEPNESVGYGSNFVAEQPMTIGIVACGYADGYQRISPTGTPVLVDSVRTRT
VGRVSMDMLAVDLTGIESAKVGSEVVLWGQSSTGVILPIDDVAVSSGTVGYELMCAVTAR
VQFINQV
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtcctattaccgcagtgatccaccgtcaagccttacaaaataacttggcggtg
gtgcgcaaggctatgccaaacagtaaggtctttgccgttgtcaaagccaatgcttatgga
catggaattgaacgtgtctatgaagcatttaaagcagcagatggctttgccttactggat
attgaagaagcaaaacgaattcgtgctctaggttggacgggtccgattttattgctcgaa
ggagttttctctcctcaagatttatttgattgtgtgcaatatcaactcagtttcaccatt
catagtgaagcgcaaattgagtgggtagaacagcatccttatccggctcaatttgatgtt
ttcttgaaaatgaacagtggtatgaaccgtcttggttttaaaccacagcattatgttcag
gcttgggaacgtttaaataatttggcaaatgtcgccaagattacccacatgatgcatttt
tcggatgcagatggcgatcgtttcggtcagcaaggtattgattatcaaattactgccttt
gaagaaattgtgaaggatttaccgggtgaaagatcggtaagtaatagtgcggcaattctg
cgttatcaagaccagctcaaatcagattatgtccgtagcggcatcatgctttatggcagc
tcgccagattacccaacccatagtattgcggattggggcttgcagccgaccatgagctta
cgtagtgaaattatttccgttcagcatttggagccgaatgaaagtgtaggttatggctca
aactttgtcgcagagcaacccatgacgattgggattgtggcttgtggttatgccgatggt
tatcaacgtatttcgccaacaggtacaccggttttagtggactcagtacgcacgcgtaca
gttggccgcgtcagtatggatatgttggcagtcgatttaacgggtattgagagcgccaaa
gttggtagtgaagtggtgctctggggtcagtcaagtacaggcgtcattttacctatagat
gatgttgcagtttcatccggtacggtgggttatgaactgatgtgtgccgtcaccgcccgt
gttcaatttattaatcaggtataa

DBGET integrated database retrieval system