KEGG   Actinoalloteichus sp. ADI127-7: UA74_11645Help
Entry
UA74_11645        CDS       T04639                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase family protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
acad  Actinoalloteichus sp. ADI127-7
Pathway
acad00250  Alanine, aspartate and glutamate metabolism
acad00410  beta-Alanine metabolism
acad00640  Propanoate metabolism
acad00650  Butanoate metabolism
acad01100  Metabolic pathways
acad01120  Microbial metabolism in diverse environments
Module
acad_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:acad00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    UA74_11645
   00650 Butanoate metabolism
    UA74_11645
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    UA74_11645
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    UA74_11645
Enzymes [BR:acad01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     UA74_11645
Amino acid related enzymes [BR:acad01007]
 Aminotransferase (transaminase)
  Class III
   UA74_11645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: APU14389
LinkDB All DBs
Position
2618925..2620178
Genome map
AA seq 417 aa AA seqDB search
MAQLSPLLKQATPVQVARGEGVYLYDHDGRRFLDFTAGIGVTSTGHCHPKVVAAAQQQVA
TLIHGQYTTVMHQPLLTLTERLGEVLPTGLDSLFYVNSGSEAVEAALRLSRQASGRQNVV
VFQGSFHGRTFGAASLTTSGAKIRAGIGPLVPGVTVAPFPYAYRYGWSEQEAVDFALREL
DYLLLTASPAADIAAFFVEPVLGEGGYVPAPPGFLAGLRERADRHGILLVFDEVQTGFGR
TGRFWGHQHFGVEPDILITAKGLASGFPLSAIAASTELMSRGLPGSQGGTYGGNAVSCAA
AVATLEVILEEGLVENAARTGERLLAGSRRIAADHAAVGDVRGLGLMVASEFVESDGSPA
PDTANRVHRAAADLGLLLLTCGPHGNVVRMIPPLVVDEAQIDQGLEIWSKAVAAGLG
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggctcagttgtcgccactgctcaagcaggcaactccggtgcaggtcgcccgaggagag
ggcgtctacctctatgaccacgacggtaggcgtttcctcgacttcaccgccgggatcggc
gtcacgagcaccggacactgtcacccgaaggtcgtcgcggccgcgcagcagcaggtcgcc
acgctgatccacggccagtacaccaccgtcatgcaccagccgctgctcacgctgaccgaa
cggctgggcgaggtgctgcccaccgggctcgactcgctgttctacgtcaactccggcagc
gaggcggtggaggcggccctgcgactgtcgcggcaggcgagcggcaggcagaacgtggtg
gtgttccagggctccttccacggccggaccttcggcgccgcgtcactgaccacttccgga
gccaagatccgggcaggcatcggaccgctggtccccggtgtcaccgtggcgccgttcccc
tacgcctaccgttacggatggtccgaacaggaggccgtcgacttcgccctgcgggaactc
gactatctgctgctcaccgccagccccgccgccgacatcgccgcgttcttcgtcgagccg
gtcctcggtgagggcggctacgtccccgcgccgcccgggttcctggcgggccttcgcgag
cgggccgaccggcacggcatcctgctcgtgttcgacgaggtgcagaccggattcggtcgg
accggccgattctggggacaccagcacttcggcgtcgagcccgacatcctgatcaccgcc
aagggactggccagcggcttccccctctccgcgatcgccgcgagcaccgagctgatgagc
cgtggcctgcccggttcgcagggcggcacctacggtggcaacgccgtgtcctgcgccgcc
gccgtggcgaccctggaggtcatcctggaggaggggctcgtcgagaacgcggcccgtacc
ggtgagcgactgctggccggttcccgccggatcgcggccgaccatgcggccgtcggcgac
gtgcgcggcctcggcctgatggtggcctccgagttcgtcgagtccgacgggtctcccgcc
ccggacacggcgaaccgcgtgcatcgggcggcagccgacctcggcctgctgctgctcacc
tgcggtccgcacggcaacgtggtccggatgatcccgccgctggtcgtcgacgaggcccag
atcgatcagggtctggagatctggtccaaggcggtcgccgccgggctgggctga

DBGET integrated database retrieval system