KEGG   Acinetobacter baumannii ATCC 17978: A1S_0096Help
Entry
A1S_0096          CDS       T00486                                 

Definition
(GenBank) alanine racemase 2 PLP-binding, catabolic
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
acb  Acinetobacter baumannii ATCC 17978
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:acb00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    A1S_0096
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    A1S_0096
Enzymes [BR:acb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     A1S_0096
Peptidoglycan biosynthesis and degradation proteins [BR:acb01011]
 Precursor biosynthesis
  Racemase
   A1S_0096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
115710..116813
Genome map
AA seq 367 aa AA seqDB search
MPRPITAVIHRQALQNNLAVVRKAMPNSKVFAVVKANAYGHGIERVYEAFKAADGFALLD
LDEAKRIRALGWTGPILLLEGIFSPQDLFDCVQYQLSFTIHSEAQIEWVEQHPYPAQFDV
FLKMNSGMNRLGFKPQHYVQAWERLNNLANVAKITHMMHFSDADGDRFGQQGIDYQITAF
EEIVKDLPGERSVSNSAAILRYQDQLKSDYVRSGIMLYGSSPDYPTHSIADWGLQPTMSL
RSEIISVQHLEPNESVGYGSNFVAEQPMTIGIVACGYADGYQRISPTGTPVLVDSVRTRT
VGRVSMDMLAVDLTGIESAKVGSEVVLWGQSSTGVVLPIDDVAVSSGTVGYELMCAVTAR
VQFINQV
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtcctattaccgcagtcatccaccgtcaagccttacaaaataacttggcggtg
gtacgcaaagctatgccaaatagtaaggtctttgccgttgtcaaagccaatgcttatgga
cacggaattgaacgtgtttatgaagcatttaaagcagcagatggctttgccttactggat
cttgatgaagcaaaacgaattcgtgctttaggctggacaggcccgattttgttgctcgaa
gggattttttctcctcaagatttatttgattgtgtgcagtatcagcttagtttcaccatt
catagtgaagcgcaaattgagtgggtagaacagcatccttatcctgctcaatttgatgtt
ttcttgaaaatgaacagtggtatgaaccgtcttggttttaaaccacagcattatgtgcag
gcttgggaacgtttaaataatttggcaaatgtcgccaagattacccacatgatgcatttt
tcggatgcagatggtgatcgtttcggtcagcaaggtattgattatcaaattactgccttt
gaagaaattgtgaaggatttaccgggtgaaagatcggtaagtaatagtgcggcaattctg
cgttatcaagaccagctcaaatcagattatgtccgtagcggcatcatgctttatggcagc
tcgccagattacccaacccatagtattgcggactggggcttgcagccgaccatgagctta
cgtagtgaaattatttccgttcagcatttggagccgaatgaaagcgtaggttatggctca
aactttgtcgcagagcaacccatgacgattggaattgtggcttgtggctatgccgatggt
tatcaacgtatttcgccaacaggtactccggttttagtggattcagtacgcacgcgtaca
gttggccgcgtcagtatggatatgttggcagtcgatttaacgggtattgagagtgccaaa
gttggtagtgaagtggtgctctggggtcaatcaagtacaggtgtcgtcttacctattgac
gatgtcgcagtttcatccggtacggtgggctatgaactgatgtgtgctgtcaccgcccgt
gttcaatttattaatcaggtataa

DBGET integrated database retrieval system