KEGG   Pseudarthrobacter chlorophenolicus: Achl_1170Help
Entry
Achl_1170         CDS       T00834                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ach  Pseudarthrobacter chlorophenolicus
Pathway
ach00020  Citrate cycle (TCA cycle)
ach00480  Glutathione metabolism
ach01100  Metabolic pathways
ach01110  Biosynthesis of secondary metabolites
ach01120  Microbial metabolism in diverse environments
ach01130  Biosynthesis of antibiotics
ach01200  Carbon metabolism
ach01210  2-Oxocarboxylic acid metabolism
ach01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Achl_1170
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Achl_1170
Enzymes [BR:ach01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Achl_1170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ACL39161
JGI: Achl1170
UniProt: B8HEP5
LinkDB All DBs
Position
1285635..1287854
Genome map
AA seq 739 aa AA seqDB search
MSKIIYTHTDEAPMLATYSFLPIIEAFASTAGVEVETRDISLAGRIIAVFGDYLTPEQQT
GDALAELGELAKTPEANIIKLPNISASIPQLKAAIAELQGQGYALPDYPDNPSSDEETAV
RSRYDKIKGSAVNPVLREGNSDRRAPLSVKNYARQNPHSMGAWTADSKTNVATMGQNDFR
SNEKSVVIESEGTIAIQLVREDGSVKVLKKAFPVLAGEVIDGTVMRAAALDEFLKDQVAR
AKEEGVLFSAHLKATMMKVSDPIIFGHVVKAYFSELFDTYGKQLAAAGISPNNGLAAILS
SLEDLPADVRDGVQNLIKKGLEDGPALAMVDSDKGITTLNVPSDVIVDASMPAMIRSSGH
MWGPDGKEADTLAVLPDSSYAGIYQVVIDDCRANGAYDPTTMGTVPNVGLMAQAAEEYGS
HDKTFEIQETGTVQVVDGTGNVLIEHEVSEGDIWRACQTKDAPIRDWVKLAVTRARASQT
PAVFWLDEERAHDANLIAKVNEYLKDHDIEGLDLQILSPVKATAFTLERIRKGEDTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLMNGGGLFETGAGGSAPKHVQQLLKENHLRWD
SLGEFLALAVSFEHLATTTGNARAQVLADTLDRATGTFLLENKSPSRRAGELDNRGSHYF
LARYWAEELAKQTDDADLAAAFGAVATELSSQEEAIVGELAAVQGSPVDVGGYYHPEDAK
ASAVMRPSATLNKVIDSLS
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagattatctacacccacaccgacgaagcgccgatgctggctacctattcgttc
ctgccgatcatcgaggcgttcgcttcgacagcaggtgtggaggtggagacccgcgacatc
tcgctcgccggccgcatcatcgctgtgttcggcgattacctcacccccgagcagcagacc
ggtgacgccctcgctgaactgggtgagctggcgaagacgccggaagccaacatcatcaag
ctgcccaacatcagcgcgtccatcccgcagctgaaggccgccattgcagagctgcagggc
cagggctacgcactgccggactacccggacaacccctcctcggatgaagagaccgctgtc
cgctcgcgctacgacaagatcaagggctccgccgtgaacccggtcctgcgcgaaggcaac
tcggaccgccgcgctccgctgtccgtgaagaactacgcgcgccagaacccgcactccatg
ggtgcctggaccgctgattccaagaccaacgtggccaccatgggccagaacgacttccgc
tccaacgagaagtccgtagttatcgaatcggaaggcaccatcgccatccagctggtccgt
gaagacggctcggtgaaggtcctcaagaaggccttcccggttctggccggcgaggtcatc
gacggaaccgtcatgcgcgccgcagccctggacgagttcctcaaggaccaggttgcccgc
gccaaggaagagggcgtgctgttctccgcacacctcaaggccaccatgatgaaggtttcg
gaccccatcatcttcggccacgtggtcaaggcctacttctccgagctcttcgacacctac
ggcaagcagctcgccgccgccggcatcagccccaacaacggccttgccgccatcctcagc
agcctcgaggacctgccggcggacgtccgcgacggcgtccagaacctcatcaagaagggc
ctcgaagacggccccgccctggccatggtggactcggacaaggggatcaccaccctgaac
gtcccgtccgacgtgatcgtggacgcctccatgccggccatgatccgcagctccggccac
atgtggggcccggacggcaaggaagccgacaccctggcggtcctgccggacagctcctac
gccggcatctaccaggtggtcatcgatgactgccgcgccaacggcgcctacgaccccact
accatgggcaccgtccccaacgtgggcctcatggcacaggcagccgaagaatacggcagc
cacgacaagaccttcgaaatccaggaaaccggcaccgttcaggtggttgacggaaccggc
aacgtgctgatcgaacacgaagtctccgagggcgacatctggcgcgcctgccagaccaag
gacgcccccatccgcgactgggtaaagctggccgtcacccgtgcccgcgcctcccagacg
cccgccgtgttctggctggacgaggagcgcgcccacgacgccaacctcatcgccaaggtc
aacgaatacctgaaggaccacgacatcgagggcctggacctccagatcctgtccccggtc
aaggccaccgcgttcaccctggagcggatccgcaagggcgaagacaccatctccgtcacc
ggcaacgtcctccgcgattacctcacggacctcttccccatcctggaactgggcaccagc
gccaagatgctctccgtggtgccgctgatgaacggtggcggactcttcgagaccggcgcc
ggcggttccgccccgaagcacgtccaacagctgctgaaggagaaccacctccgctgggac
agcctgggcgaattcctggccctggccgtcagcttcgagcacctggccaccaccaccggc
aacgcccgcgcccaggtcctggccgacacgctggaccgcgccaccggcacgttcctgctg
gagaacaagtccccgagccgccgcgccggcgaactggacaaccgcggcagccactacttc
ctggcccgctactgggccgaggaactggccaagcagacggacgacgccgacctggccgcc
gcattcggcgccgtcgccaccgaactttcctcccaggaggaagccatcgttggtgagctg
gccgcggtccagggctcgcccgtggacgttggaggctactaccaccccgaggacgccaag
gcctctgcagtcatgcggccgtccgcgaccctgaacaaggtcatcgacagcctgagctag

DBGET integrated database retrieval system