KEGG   Pseudarthrobacter chlorophenolicus: Achl_3384Help
Entry
Achl_3384         CDS       T00834                                 

Definition
(GenBank) conserved repeat domain protein
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
ach  Pseudarthrobacter chlorophenolicus
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ach00001]
  Lipid metabolism
   00600 Sphingolipid metabolism
    Achl_3384
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Achl_3384
Enzymes [BR:ach01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     Achl_3384
Bacterial toxins [BR:ach02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   Achl_3384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(3750276..3753212)
Genome map
AA seq 978 aa AA seqDB search
MGQAAGIGALAVALLAGTGLPAQAAPIPSTSPTAPPGAFQETNLAADRTANNFFYRIPAL
SYLGNGVVLAAWDGRPGSAADAPNPNSIVQRRSTDGGRTWGPVQVIAAGHVGDAAAPKYG
YSDPSYVYDAEAGKVFAFFVYSKDQGFGGSQFGNDDADRNVISSAVIESSDGGTTWSQPR
LITGVTKPGTSKTNPVAGDVRSNFASSGEGIQLKYGPYKGRLIQQYAGDIRQADGSNRIQ
AYSVYSDDHGATWHKGANVGDRMDENKTVELSDGRVLLNSRDNANQGYRKVAVSTDGGAT
YGPVTQDTELPDPANNGAIARMFPNAAQGTADAKKLIFTNANSKTGRENVSARVSCDDGA
TWPGVRTIRSGFSAYSTVTRLDEGRLGVLYEANYTDNMPFAAFDDAWLNYACAPLSVPAV
TTAPGATKQVPVTVTNQEAATLSGATVTVYTPSGWSATTVPVPDVAPGASATVNVDLTAP
ANASGPQNLNAAFTTADGRVSQAAFTATVPVAPQVGLTITGAAPDRDVAASPYKAGDVVS
YTFNVKSTANVTANSVPLSGTFEAGFLPPAPGAPSSPNCRYNNLAAGASYTCTTARHTVT
AEDMARGYFVPQATFSITASATPSLTRTVAFTGAAVALRDGLVSATITGSRNDAGRDLAA
QPYTAGEAFPYKFDVTNTSPLVEKVVPTAGNFSPFVPDGPGNCRYNVLPAGQSYTCATPR
HTVTAEEAAQGFFIPETNWDVSAAGQTIRTYGVNGGEVDLKVRDASLDGTIAAEWTDKDG
DRYASAGDTVTYTYTVGNAGNVPLTGVAAPAAGISEPSLAAGSSVTATRDYVLTAADITA
GKLDAVSFSATGDNGTRRATASVSGGGIQLELQPAQPESEPALTVQDFDGQTPPFDLKTQ
DKYRNGQKVVLEGLDYGQWYYVYLNKRSQRIGWLFPTTANTVEFILPAGIQNGRDDVVVL
DKDGKQVSFDRLQVTPKG
NT seq 2937 nt NT seq  +upstreamnt  +downstreamnt
atggggcaggctgcgggcataggggccctcgccgttgccctgctcgccggaaccggcctg
cccgcccaggcagcgcccatcccgtccaccagccccactgctcctcccggcgctttccag
gaaaccaacctggccgcggaccggaccgccaacaacttcttctaccgcatacccgccctg
tcctacctgggcaacggcgtggtcctcgccgcctgggacggcaggcccggcagcgcagcc
gatgcccccaatcccaactccatcgtgcagcgccgcagcaccgacggcggccggacctgg
gggccggtgcaggtgatcgccgccgggcacgtgggcgatgccgccgctccgaagtacggc
tacagcgatccttcctacgtttacgacgccgaggccgggaaagtcttcgcattctttgtg
tactccaaggaccaagggttcggcggcagccagttcggcaacgatgacgcggacaggaac
gtcatttcctcagccgtgatcgaatcgtccgacggcggcaccacctggagccagccccgc
ctcatcaccggcgtcaccaagccgggcaccagcaagaccaaccccgtggccggcgacgtc
cgctccaatttcgcgtcctccggcgaaggcatccagctcaagtacggtccctacaaggga
cgtctgatccagcagtacgccggggacatccgccaggcggacggcagcaacaggatccag
gcctacagcgtctactccgacgaccacggcgccacgtggcacaagggcgccaacgtgggc
gaccggatggacgaaaacaagacggtggaactctccgacgggcgcgtgctgctcaactcg
cgggacaacgccaaccagggctaccgcaaggtggcggtgtccaccgacggcggcgccacc
tacggcccggtcacgcaggacaccgaactgccggaccccgccaacaacggggccatcgca
cgcatgttccccaacgccgcgcagggcacggccgatgcgaagaagctgatcttcaccaac
gccaactccaagacggggcgcgagaacgtctcggcccgcgtgtcctgcgacgacggcgcc
acctggcccggggtccgcaccatccgctccggcttctccgcctattccaccgtgacccgg
ctggatgagggcaggttgggcgtcctgtacgaggccaattacacggacaacatgccgttc
gccgccttcgacgacgcgtggctgaactacgcctgcgcgccgctgtccgttcccgccgta
actaccgcgcccggcgccaccaagcaggtgcccgtgacggtcaccaaccaggaggctgcc
acgctctccggcgccaccgtcaccgtctacacccccagcggctggtccgccaccacggtg
cctgttcccgatgtcgcacccggcgcctccgccaccgtgaatgttgacctcaccgcgccg
gcgaacgccagcggcccacagaacctcaacgcagcgttcacgacggcggacggccgggtt
tcgcaggccgccttcacggccacggtccccgtggcaccgcaggtgggcctcaccatcacc
ggagctgcgccggaccgtgacgtcgccgcaagtccctacaaggcgggcgacgttgtcagc
tacacgttcaacgtgaagagcacggccaacgtcaccgcaaactcggtgccgctgtccggt
acgttcgaggccggcttccttccaccggcccccggggcaccaagcagccctaactgccgg
tacaacaacctggctgccggtgccagctacacctgcaccacggccaggcacacggtgacg
gccgaggacatggcccgcggctacttcgtgccgcaggccaccttcagcatcacggccagc
gcgacgccgtcgctcaccaggacggtggcgtttaccggagcggcagtagccctgcgcgac
ggcctggtttctgccaccatcacgggcagccgtaacgacgccggccgggacctcgccgcg
cagccgtacaccgcgggggaggccttcccctacaagttcgacgtcaccaacaccagcccg
ttggtggagaaggtggtgcccacagcggggaacttcagcccgttcgtgccggacggcccc
ggcaactgccggtacaacgtcctgcccgccggacagtcctacacgtgcgccacaccgcgg
cacaccgttaccgctgaggaggcagcccagggcttcttcatcccggaaaccaactgggac
gtcagcgctgctggccagaccatccggacctacggcgtgaacggcggcgaggtggacctg
aaggtgcgcgacgccagcctggacggcaccatcgcagctgaatggaccgacaaagacggc
gaccggtacgcctccgcaggcgacaccgtgacgtacacctacaccgtgggcaatgcaggc
aacgttccgctgaccggggtggctgcaccggccgcgggcatcagcgaaccgtccctggcc
gccggcagcagtgtcaccgctacccgggattacgtgctgacggcggcggacatcaccgcc
gggaagctggacgcagtaagtttcagcgccaccggggacaacgggaccaggcgtgccacc
gcttccgtgagcggcggcgggattcagcttgagctccagcccgcccagccggagtccgaa
cccgcgctgacggtccaggacttcgacggccagacgccgccgttcgacctgaagacgcag
gacaagtaccggaacggccagaaggtggtcctcgaagggctcgattatgggcagtggtac
tacgtctatctcaacaagcgcagccaacggatcggctggttgttccccaccaccgccaac
acagtggagttcatcctccccgccgggatccagaacggccgtgatgatgtggtggtcctg
gacaaggacggaaagcaggtctcgttcgaccggctgcaggtgaccccgaagggttag

DBGET integrated database retrieval system