Acanthisitta chloris (rifleman): 103801883 Help Entry 103801883         CDS       T08456                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism achl  Acanthisitta chloris (rifleman) Pathway achl04010   MAPK signaling pathway achl04012   ErbB signaling pathway achl04068   FoxO signaling pathway achl04137   Mitophagy - animal achl04140   Autophagy - animal achl04144   Endocytosis achl04150   mTOR signaling pathway achl04210   Apoptosis achl04218   Cellular senescence achl04370   VEGF signaling pathway achl04371   Apelin signaling pathway achl04510   Focal adhesion achl04540   Gap junction achl04625   C-type lectin receptor signaling pathway achl04810   Regulation of actin cytoskeleton achl04910   Insulin signaling pathway achl04912   GnRH signaling pathway achl04916   Melanogenesis achl05132   Salmonella infection Brite KEGG Orthology (KO) [BR:achl00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103801883 (HRAS)    04012 ErbB signaling pathway     103801883 (HRAS)    04370 VEGF signaling pathway     103801883 (HRAS)    04371 Apelin signaling pathway     103801883 (HRAS)    04068 FoxO signaling pathway     103801883 (HRAS)    04150 mTOR signaling pathway     103801883 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103801883 (HRAS)    04140 Autophagy - animal     103801883 (HRAS)    04137 Mitophagy - animal     103801883 (HRAS)   09143 Cell growth and death    04210 Apoptosis     103801883 (HRAS)    04218 Cellular senescence     103801883 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     103801883 (HRAS)    04540 Gap junction     103801883 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     103801883 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103801883 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     103801883 (HRAS)    04912 GnRH signaling pathway     103801883 (HRAS)    04916 Melanogenesis     103801883 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103801883 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:achl04131]     103801883 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:achl04147]     103801883 (HRAS)    04031 GTP-binding proteins [BR:achl04031]     103801883 (HRAS) Membrane trafficking [BR:achl04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     103801883 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     103801883 (HRAS) Exosome [BR:achl04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    103801883 (HRAS)   Exosomal proteins of colorectal cancer cells    103801883 (HRAS) GTP-binding proteins [BR:achl04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     103801883 (HRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N G-alpha ATP_bind_1 Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  103801883 NCBI-ProteinID:  XP_009072567 UniProt:  A0A091MTN0 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVIS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgaatacaagctggtggtggtgggagcaggtggtgttgggaagagtgctttgacg atacagctcattcagaaccatttcgttgatgagtatgaccccacaatagaggattcctac agaaagcaagtagtcatcgatggagagacctgcttgttagatatcttggacactgcaggg caagaggagtacagtgccatgagagaccagtacatgagaacgggggaaggattcctctgt gtcttcgccatcaacaacaccaagtcctttgaagatattcaccagtacagggagcagatc aagagggtgaaagactcagatgatgttcccatggtgctggtaggaaataaatgtgacctc ccggcccggacagtggagacgcggcaagcgcaggacctggcccggagttacgggatcccc tacatagaaacgtctgccaaaaccagacagggcgttgaagatgccttctacaccttggtg cgggagatccgtcagcacaagctgcgcaagctgaacccgccggatgagagcggccccggc tgcatgaactgtaaatgtgtgatctcgtga

DBGET integrated database retrieval system