KEGG   Granulicella tundricola: AciX9_0340Help
Entry
AciX9_0340        CDS       T01411                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
acm  Granulicella tundricola
Pathway
acm00473  D-Alanine metabolism
acm00550  Peptidoglycan biosynthesis
acm01100  Metabolic pathways
acm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:acm00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    AciX9_0340
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AciX9_0340
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    AciX9_0340
Enzymes [BR:acm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AciX9_0340
Peptidoglycan biosynthesis and degradation proteins [BR:acm01011]
 Precursor biosynthesis
  Amino acid ligase
   AciX9_0340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ADW67412
UniProt: E8WWT4
LinkDB All DBs
Position
411939..413057
Genome map
AA seq 372 aa AA seqDB search
MAKKKLRVGVLFGGRSGEHEVSLLSANSILKAIDRKKYEVVPIGITKQGRWLGGDGAKGL
LTGDSGLTLSASAQVTETGLIEQSGGVIGALDVIFPVLHGTFGEDGTIQGMLELADLAYV
GSGVLGSAAGMDKDVMKKLFAAAGLPQTPYLSVLRSEWKADAKGCRKRIEKALEYPLFVK
PANLGSSVGISKVHGRDELAAAMDLAAGFDRKLVVEQGVGGPGAKPRELEVAVLGNETLE
ASVVGEIVPAKEFYDYEAKYQMNGPDESVCIIPAKLSASEQKQMRAMAMEAFRACDCSGL
ARVDFLMEPAAKGKKAKFYLNEINTMPGFTSISMYPKLWGASGVGYTELIDRLIVLAQER
HAEKMATAFARE
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggctaagaagaaactgcgggttggcgttttgtttggtgggcggagtggggagcatgag
gtttcgctgctttcagcgaactcgattctgaaggcgatcgaccggaagaagtatgaggtg
gtgccgattgggatcaccaagcagggccggtggctggggggcgatggggccaaggggctg
ctgacgggggattccggtctgacgttgagtgcttccgcgcaggtgaccgagacggggctg
attgagcagagcggcggcgtcattggtgcgctggatgtgatcttcccggtgctgcatggg
acgtttggcgaggatgggacgatccaggggatgctggagttggcggacctagcttatgtg
gggtcgggcgtgctggggtcggcggccgggatggacaaggatgtgatgaagaagctgttt
gcggcggcgggtctgccgcagacgccgtacctgagcgtgctgcggagtgagtggaaggcg
gatgcgaaggggtgcaggaagaggatcgagaaggctctggagtatccgctgtttgtgaag
ccggcgaacctggggagctcggtggggatcagcaaggtgcatggacgggatgagcttgcg
gctgcgatggatctggcggcggggttcgaccggaagctggtggtggagcagggagtgggc
gggccgggggcgaagcctcgggagctggaggtggcggtgctagggaacgaaacgctggag
gcgagcgtggtgggtgagatcgtgccggcgaaggagttctacgactacgaggcgaagtac
cagatgaatgggccggacgagagtgtatgcatcattccggcgaagctgagtgcgagcgag
cagaagcagatgcgggcgatggcgatggaggcctttcgggcttgtgactgctcgggtctg
gcgcgggtggattttctgatggagcctgcggcgaagggcaagaaggcgaagttctatctg
aacgagatcaatacgatgccgggattcacttcgatctcgatgtatccgaagctttggggt
gcgagcggggtggggtatacggagctgatcgatcgtctgattgtgctggcgcaggagcgt
catgcggagaagatggctacggcatttgcccgagagtaa

DBGET integrated database retrieval system