KEGG   Granulicella tundricola: AciX9_1331Help
Entry
AciX9_1331        CDS       T01411                                 

Definition
(GenBank) alpha amylase catalytic region
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
acm  Granulicella tundricola
Pathway
acm00500  Starch and sucrose metabolism
acm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AciX9_1331
Enzymes [BR:acm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AciX9_1331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1939
Motif
Other DBs
NCBI-ProteinID: ADW68393
UniProt: E8WVE5
LinkDB All DBs
Position
complement(1558872..1560263)
Genome map
AA seq 463 aa AA seqDB search
MAVMMQAFYWDAPKLENREHDFWNFIAERVEDLGKAGINALWLPPINKGSSNTSMGYDPY
DFFDLGDFDQKGGTKTWYGNRAELEALITKAHANSVGVYADMVINHNSGADEEEVNPLDG
EKRWTKFNPASGIFPRDWNSFHPSRFERTMVEGEHFAGFPHLCHRNPSVYKAMFDYARLI
IEDLDFDGFRFDFVKGYGSWMISLLSKYQYEKKDMKEFMPYVVCELWSGGDDIDMWLDKA
NSVTDNQIAAFDFPLRYQLKAVCDQPNYDLRNLTRDGSVVMARPAHAATFVDNHDMGEDI
IQNDKLMAYSFIMVHEGYPCIFWFDYYNNGLARPFTPNGINALIEAHHKYAGGDSQILHA
DPDLYIMQRVGWKDDKTDQPGLVYVLNNLGDKWSGTSVKTKWCNQRMVPIAWDGHGLYGE
VAHPDERRTDAEGNCEFPAPPRGYCIYVPIADDANKDEAIAGV
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcatgatgcaggccttctattgggatgcgccgaagctcgaaaaccgcgaacac
gacttctggaacttcatcgcggagcgcgtagaagacctgggcaaagccggcatcaacgcc
ctctggctcccacccatcaacaagggctccagcaatacctccatgggctacgacccatac
gacttcttcgacctcggagacttcgaccagaagggcggcaccaagacctggtacggcaac
cgcgctgagctcgaagccctcatcaccaaggcccacgccaactcggtcggcgtctacgcc
gacatggtcatcaaccacaactccggcgcagacgaggaggaggtcaaccccctcgacggc
gaaaagcgctggaccaagttcaacccggccagcggcatcttcccccgcgactggaactcc
ttccaccccagccgcttcgaacgcaccatggtggagggcgagcacttcgccggcttcccc
catctctgccaccggaacccgtcggtctacaaagcaatgttcgactacgcccgactcatc
atcgaagatctcgacttcgacggcttccgcttcgacttcgtcaagggctacggaagctgg
atgatcagcctcctctcgaaataccagtatgagaagaaggacatgaaggagttcatgccc
tatgtcgtctgtgagctatggtccggcggtgacgacatcgacatgtggctcgacaaggcc
aacagcgtcaccgacaaccagatcgccgccttcgacttccccctgcgctaccagctcaag
gccgtgtgcgaccaacccaactacgacctccgcaacctcacccgcgacggatccgtcgtc
atggcccgccccgcccacgccgccaccttcgtcgacaaccacgacatgggcgaagacatc
atccagaacgataagctcatggcctactccttcatcatggtccatgagggctacccctgc
atcttctggttcgactactacaacaacggccttgcccgccccttcacccccaacggcatt
aacgccctcatcgaagcccaccacaagtacgccgggggcgactcccagatcctccacgcc
gaccccgacctctacatcatgcagcgcgtcggctggaaggatgacaagaccgaccaaccc
ggcctcgtctacgtcctcaacaacctgggcgacaagtggtccggcacctcggtcaagaca
aagtggtgcaaccagcgcatggtccccatcgcatgggacggccacggcctgtacggggag
gtcgcccaccccgacgagcgccgcaccgacgccgaaggcaactgcgagttccccgcccca
ccccggggctactgcatctacgtccccatcgcagacgacgcgaacaaggatgaggcaatc
gccggagtttag

DBGET integrated database retrieval system