KEGG   Anaeromyxobacter dehalogenans 2CP-1: A2cp1_1939Help
Entry
A2cp1_1939        CDS       T00833                                 

Definition
(GenBank) Peptidyl-dipeptidase A
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
acp  Anaeromyxobacter dehalogenans 2CP-1
Brite
Enzymes [BR:acp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     A2cp1_1939
Peptidases [BR:acp01002]
 Metallo Peptidases
  Family M2
   A2cp1_1939
Exosome [BR:acp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A2cp1_1939
CD molecules [BR:acp04090]
 Proteins
  A2cp1_1939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
2191241..2193085
Genome map
AA seq 614 aa AA seqDB search
MTTLPVLQLAAVLLAATPSAPAAPPQPAAAAKPTAADAKAFVGEANAELKKLWIRWSTAE
WIKSTYITDDTERNAAALNEDQMAYLTDAIRGAVRFQGVGADPDTERMLMLLRIASPLPA
PSDAAQRAELAQLAAKLEGMYGKGKWCGAPGSAARGAEKCRDLQDLEQVMAKSRDYDALL
DAWTGWHTISRDMRPLYERMVTISNAGAREIGFRDLGDLWRSGYDMPPDAFEADTDRLWA
QVKPFYEELHCYVRSKLQKAYGKARVPDGKPIPAHLLGNMWAQDWANLYPLVEPYHGQPS
LDVDAALRRQKTDPIKMVKLGEAFFTSLGFEPLPKTFWERSQFTKPRDRDVVCHASAWDV
TYSADLRIKMCIRPTEEDLVTIHHELGHNFYQRAYVHLPVLFQNGANDGFHEAIGDAIAL
SITPGYLKQVGLIQTVPKDEKGVVNVQMKRALEKVAFLPFGKLIDQWRWDVFSGKTPASR
YNAAWWELRRKYQGVDAPVSRSEADFDPGAKYHVPANVPYTRYFLAHVYQFQFHKALCEA
AGWKGPLHECSIYGSKAAGKKLDAMLAMGASRPWPEAYAALTGSRQADASAMLEYFAPLR
AWLRKQIAGQSCGW
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgacgacactcccggtcttgcagctcgcagccgtcctcctcgccgcgacgccctccgcg
ccggcggcgcccccgcagcccgcagccgccgcgaagcccaccgccgccgacgcgaaggcg
ttcgtgggcgaggcgaacgccgagctgaagaagctctggatccgctggtccaccgcggag
tggatcaagtccacctacatcaccgacgacaccgagcggaacgccgcggccctcaacgag
gaccagatggcctacctgaccgacgcgatccgcggcgcggtccggttccagggcgtcggc
gccgaccccgacaccgagcgcatgctgatgctgctgcgcatcgcctcgccgctcccggcg
ccgagcgacgccgcgcagcgcgccgagctggcgcagctcgccgcgaagctcgagggcatg
tacggcaagggcaagtggtgcggcgcgcccggcagcgcggcgcgcggcgccgagaagtgc
cgcgacctgcaggatctcgagcaggtgatggccaagagccgcgactacgacgcgctgctc
gacgcctggaccggctggcacaccatctcgcgcgacatgcgcccgctctacgagcggatg
gtgaccatctccaacgcgggcgcgcgcgagatcggcttccgcgacctcggcgacctgtgg
cgcagcggctacgacatgccgcccgacgcgttcgaggccgacaccgaccggctctgggcg
caggtgaagccgttctacgaggagctgcactgctacgtccgcagcaagctgcagaaggcc
tacggcaaggcgcgggtgccggacggcaagcccatcccggcgcacctgctcggcaacatg
tgggcgcaggactgggccaacctctacccgctggtcgagccgtaccacgggcagccgtcg
ctcgacgtggacgcggcgctgcgccggcagaagaccgatcccatcaagatggtgaagctg
ggcgaggcgttcttcacctcgctgggcttcgagccgctcccgaagacgttctgggagcgc
tcgcagttcacgaagccgcgcgaccgcgacgtggtgtgccacgccagcgcctgggacgtg
acctactccgccgacctgcgcatcaagatgtgcatccggccgaccgaggaggacctcgtc
accatccaccacgagctgggccacaacttctaccagcgcgcctacgtgcacctgccggtg
ctgttccagaacggcgcgaacgacggcttccacgaggccatcggcgacgcgatcgcgctg
tccatcacccccgggtacctgaagcaggtcggcctgatccagaccgtgccgaaggacgag
aagggcgtggtgaacgtgcagatgaagcgcgcgctcgagaaggtcgcgttcctgccgttc
ggcaagctcatcgaccagtggcgctgggacgtgttctccggcaagacgccggcgtcgcgc
tacaacgcggcctggtgggagctgcgccgcaagtaccagggcgtggacgcgccggtctcg
cgcagcgaggcggacttcgatccgggcgcgaagtaccacgtgcccgcgaacgtgccctac
acgcgctacttcctcgcgcacgtgtaccagttccagttccacaaggcgctgtgcgaggcc
gccgggtggaaggggccgctgcacgagtgctcgatctacggctcgaaggccgccggcaag
aagctcgacgccatgctggccatgggcgcgtcgaggccgtggcccgaggcctacgccgcg
ctgaccggctcgcgccaggcggacgcgtccgccatgctcgagtacttcgcgccgctgcgc
gcctggctccggaagcagatcgccggccagtcctgcggctggtag

DBGET integrated database retrieval system