KEGG   Anolis carolinensis (green anole): 100551888Help
Entry
100551888         CDS       T01608                                 

Gene name
gpd2
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase 2
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100551888 (gpd2)
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     100551888 (gpd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
Un
AA seq 727 aa AA seqDB search
MAFRKAMKGAVLVGGGAVATVFALSQLSQYRKKHSHLVSVEASECKPLQMHRSLPTREHQ
LQALQQTSEFDVLIIGGGATGSGCALDAVSRGLKTALVERDDFSSGTSSRSTKLIHGGVR
YLQKAIMKLDFDQYRMVKEALHERANLLEIAPHLSSPLPIMLPVYKWWQLPYYWVGIKLY
DLVAGSQCLKSSYVLSKSKALELFPMLQKDRLVGAIVYYDGQHNDARMNLAIALTAARYG
AAIANYTEVMHLLKKTDPNSGKSHVCGARCRDVLTGQEFDVNAKCVINATGPFTDSVRKM
DDQEVLNICQPSAGVHIVMPGYYSPDNMGLLDPSTSDGRVIFFLPWQKMTIAGTTDTATE
VTHHPIPTEEDINFILTEVRNYLSCDVEVRRGDVLAAWSGIRPLVTDPNSKDTQSISRNH
VVHVSDSGLVTIAGGKWTTYRSMAEDTIDAAVKAHGLKAGPCKTSGLLLQGAEGWSPTLY
IRLVQDYGLESEVAQHLSNTFGDKAFEVAKLAQVTGKRWPIVGKRLVSEFPYIESEIEYG
IQEYACTAVDMIARRTRLAFLNVQAADEALPRIIEIMGKRLKWSEQKKKEQLEEAKKFLY
YEMGYKARSEQLTDRSEITLSPRDIERYKKRFHMFDKEGKGFITILDVQRVLESINFQIN
ESALHEILTEVDLNKNGQVELNEFLQLMTAIQKGSISGSRLAVLMKAAEENICRREVISV
DRSGGGL
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggcatttcgaaaggcaatgaaaggagctgtcctcgttgggggtggtgctgtagcaacc
gtttttgccctctcacaactttctcaatatagaaaaaaacacagtcatctggtgtctgtt
gaagcttctgaatgtaaacccttacagatgcatagatcccttcccaccagagaacatcaa
ctacaggccttgcaacagaccagtgaattcgatgtccttatcataggcggaggtgctact
ggtagtggttgtgccttagatgcagtttcaagaggcctaaaaacagcccttgtagaaaga
gatgatttctcatcagggaccagcagcagaagcactaaactgatccacggaggagtgaga
taccttcagaaggccatcatgaagttggattttgaccagtacagaatggtgaaagaagct
ctccatgaacgtgccaacttgcttgaaattgcacctcatctatcttctcctttgccgatt
atgcttcccgtttacaaatggtggcagctgccatattattgggtgggaattaaactctac
gaccttgtagcgggaagccagtgcctgaaaagtagctatgtgcttagcaaatcaaaagcc
ctggaactctttcctatgctgcagaaggacagacttgtaggtgccattgtctactatgat
ggacaacacaacgatgcacgaatgaaccttgccattgccctcactgctgccaggtatggt
gctgccatagccaattacactgaagtgatgcacttgctgaagaagacagatccaaatagt
gggaagagccacgtctgcggagcaaggtgcagggatgttctcacagggcaggaatttgat
gtcaacgccaaatgtgttatcaatgctacaggacctttcacagactctgtgcgaaaaatg
gatgatcaggaagtactgaacatctgtcaaccaagcgcaggcgttcatattgtgatgcct
ggctattatagcccagataacatgggactcctggacccatccactagtgatggacgagtg
attttcttcttgccctggcaaaagatgactattgctggtaccacggacactgcaactgaa
gtcacacatcatccaattcctacagaagaagacatcaacttcattttgacagaagttcgc
aactatctgagttgtgatgtggaagtgaggagaggagatgttttagctgcatggagtggg
attcgtccccttgtaacagaccccaattctaaagacacacagtccatctccaggaaccat
gtggtacatgttagtgacagtggacttgtgaccatagcaggtgggaaatggacaacatat
cgctcaatggcagaagatactattgatgctgctgtgaaagctcatggtctcaaagctggc
ccatgtaagacttcaggacttctccttcagggtgcagagggttggagccctactctttat
atccgtctggttcaggattatggactggaaagcgaggtggctcaacatctttcaaataca
tttggagacaaagcttttgaagtagccaagttagctcaggtgactggaaagagatggcct
attgttggaaaacgtctcgtgtcagaatttccttacattgaatcggagattgaatatggg
atccaagagtatgcctgcactgccgtggatatgattgcccgccgcacacgtttggctttc
ctgaatgtacaagcagctgatgaagccttaccaagaatcattgagatcatggggaaaaga
ctgaaatggagtgaacagaagaagaaggagcagcttgaggaggcaaagaagttcctttac
tatgaaatgggctacaaggcacggtcagagcaattgacggatcgtagtgaaatcactctg
tccccaagggatattgaaagatacaaaaagaggttccacatgtttgataaggaaggcaaa
ggttttattaccattttggacgttcagcgtgtgttagagagcatcaactttcaaattaat
gaaagtgcactccatgagattttgactgaagtggatttgaacaaaaacgggcaggttgaa
ctcaatgaatttttgcaactcatgactgctattcagaaaggatctatttctggaagccgg
ctagccgtacttatgaaagccgcggaagagaacatttgtcggcgtgaagtgatttcagtg
gatcggagtggaggtggactgtga

DBGET integrated database retrieval system