KEGG   Anolis carolinensis (green anole): 100551994Help
Entry
100551994         CDS       T01608                                 

Gene name
sod1
Definition
(RefSeq) superoxide dismutase 1
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:acs00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    100551994 (sod1)
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     100551994 (sod1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
3
AA seq 221 aa AA seqDB search
MERSRVTMRLPHLAKAGLERHIAWRLGGRRQAQGIKTRGGGPVLGGASSDGVIMLSAGVK
GNMAVQKAVCLLTADPATGSNVCGVVRFEQQGDGEVRVAGQLQGLTIGKHGFHVHEFGDN
TNGCTSAGAHFNPENQTHGGPQDEMRHVGDLGNVEANGSGVADVDITDCVISLSGPHSVI
GRTLVVHAKPDDLGRGGNDESLKTGNAGARLACGVIGLAKA
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggagagaagccgggtgacgatgaggctgcctcacttggcgaaggcgggcctagaacgt
cacattgcctggcgattggggggcaggcggcaagcgcagggcataaaaacgcgaggaggc
gggcccgtgctcggtggcgcaagcagcgacggtgttattatgttatctgcgggagttaag
ggcaacatggcggtgcagaaagcggtctgcttgctgacggccgacccggccaccgggagc
aatgtctgcggtgtcgttcgcttcgagcagcagggtgatggagaagtgcgtgttgcaggc
caacttcagggattgactataggaaagcatggattccatgtccatgaatttggagacaac
acaaatggatgtaccagtgctggtgctcacttcaatcctgagaatcaaacacatggcggg
ccgcaagatgaaatgaggcatgttggtgatctgggaaatgtggaggcaaatggctctggt
gtggcagacgtggacataaccgactgtgttatttctctctcggggccacattcagttatc
ggacgtactctggtggttcatgcaaaaccggatgatctgggcagaggaggaaatgatgag
agcttgaaaactggaaatgctggtgctcgcctagcttgcggtgtgattggactggctaag
gcctag

DBGET integrated database retrieval system