KEGG   Anolis carolinensis (green anole): 100553897Help
Entry
100553897         CDS       T01608                                 

Gene name
suv39h1
Definition
(RefSeq) suppressor of variegation 3-9 homolog 1
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100553897 (suv39h1)
Enzymes [BR:acs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100553897 (suv39h1)
Chromosome and associated proteins [BR:acs03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100553897 (suv39h1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100553897 (suv39h1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo
Motif
Other DBs
NCBI-GeneID: 100553897
NCBI-ProteinID: XP_003216705
Ensembl: ENSACAG00000006321
UniProt: G1KF95
LinkDB All DBs
Position
2
AA seq 414 aa AA seqDB search
MAENLKACTVCCKSTWSQLQDLCRLEKLCCPNLGITRKNLCDFEVEYLCDYKKVRDEEYY
LVKWRGYPESENTWEPRKHLRCINILKQFHRDLEQAFIRRGGKLRKNISLLDQGISSYLV
QKAKQRKALQNWEYELNVKRNHKGRIVVENEVDLSGPPRDFVYINEYKVGEGITLNQVAV
GCECFDCLSEAAGGCCPGASHHKFAYNELGQVKIKAGLPIYECNSRCNCGMDCPNRVVQK
GIRYDLCIFQTANGRGWGVRTLERIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLF
DLDYVEDVYTVDAAYYGNISHFVNHSCNPNLQVYNVFIENLDERLPRIAFFATRCIHAGE
ELTFDYNMHVDPVNEESTRMDSNFGLVGGLGGSPKKRMRIECKCGTESCRKYLF
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaatttaaaagcttgtactgtttgctgcaagtcaacttggtctcagcttcaa
gatctgtgtcgtttggagaagttgtgctgcccaaacttgggcattaccagaaaaaacctt
tgtgattttgaagtggaatatctgtgtgactacaagaaagtccgtgatgaggaatactac
ctggtgaagtggcggggctaccctgagtcagaaaacacctgggaacccaggaagcacctg
cgttgtatcaacatactgaaacagttccaccgggacctagagcaagcctttatccggcga
ggagggaaactcaggaagaacatttccttgctagaccaaggcatctccagctacctggtg
cagaaggctaaacagcgaaaagctttgcaaaactgggaatatgagcttaatgtcaaacgc
aaccacaagggacggattgtggtagaaaatgaggtggacctgagtgggcctccccgggac
tttgtctacattaatgaatataaggtcggggagggcataactctcaaccaggtggctgtg
ggctgtgagtgcttcgactgtttgtcagaagcagctggcggttgctgccctggtgcctcc
catcataaatttgcatataatgaactgggccaagtgaagatcaaggctggcttgcctatc
tacgagtgcaattctcgctgcaactgtgggatggattgccccaatcgggtggtacagaaa
ggcattcgttacgacctttgcattttccagactgctaatggacgtggctggggtgtgcgc
acgttggagaggatacggaagaacagctttgttatggaatatgtgggagagatcatcaca
tcggaagaagctgaacggcggggacagatctatgaccgacagggtgctacttacctgttt
gacctggactatgtagaagatgtatatacagtcgatgctgcttactatggcaacatttct
cattttgtcaaccacagttgtaatcccaacctacaggtgtacaatgtcttcattgaaaat
ttggatgagcggctgcctcgcattgccttctttgctactcgatgtattcatgctggggag
gaacttacttttgactacaacatgcatgtggacccagtaaatgaagaaagtacaaggatg
gactctaattttggcctagtgggaggccttggtggttcaccaaagaagcggatgcgcatt
gagtgtaagtgtggcacagagtcctgccggaagtacctcttctag

DBGET integrated database retrieval system