KEGG   Anolis carolinensis (green anole): 100560130Help
Entry
100560130         CDS       T01608                                 

Gene name
ptgs2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00590  Arachidonic acid metabolism
acs01100  Metabolic pathways
acs04370  VEGF signaling pathway
acs04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100560130 (ptgs2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    100560130 (ptgs2)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    100560130 (ptgs2)
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     100560130 (ptgs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2
Motif
Other DBs
NCBI-GeneID: 100560130
NCBI-ProteinID: XP_003223472
Ensembl: ENSACAG00000001178
UniProt: H9G4Z6
LinkDB All DBs
Position
Un
AA seq 602 aa AA seqDB search
MLLPCAVLFALLALSHAVNPCCSNPCHNRGVCMTTGFDTYACDCTRTGYYGENCTTPEFL
TWLKLKLKPTPDMVHYILTHFKGVWNIINNIPFLHRAIMTYILMSRSHLIESPPTYNGHY
SYKSWEAYSNLSYYTRSLPPVEHNCPTPMGIKGKKELPDSQIIVEKFLMRRKFIPDPQGT
NVMFTFFAQHFTHQFFKTDHRKGPEFTKGLGHGVDLSHIYGETLDRQMKLRLLKDGKLKF
QMIDGEMYPPTVKDTQAEMIYPPHIPEHLRFCVGQEVFGLVPGLMMYATLWLREHNRVCD
VLKGEHPEWDDEQLFQTTRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQRFQYQ
NRIAAEFNTLYHWHPLLPDTFNIQDQEYTYQQFVYNNSIMLDHGLSHMVQSFSKQIAGRV
AGGRNVPVAVLKVAKASIDQSRQMRYQSLNEYRKHFLLKPFQSFEELTGEKEMAAELKEL
YGDIDAMELYPALLVEKPRPGAIFGETMIELGAPFSLKGLMGNAICSPEYWKPSTFGGKV
GFDIVNTASLQRLVCNNVAGCPLTAFHVLTQETKATSNTSTTSASLDEINPAVLLKERSA
EL
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgctgctcccctgcgccgtcctctttgccctcctggctttgagccacgctgttaatcct
tgctgttcaaatccatgccataacagaggagtgtgcatgacaacaggttttgacacatat
gcttgtgactgtacacgaactggatattacggggaaaactgcactacacctgaatttttg
acctggctgaaactgaaattgaagcctactcctgacatggtccactacatactcactcac
ttcaaaggtgtctggaacatcatcaacaacatcccattccttcacagagccatcatgaca
tatatattgatgtcaagatcccacttaatagagagtccaccaacatataacggccattac
agttacaaaagctgggaagcctactcaaacctttcatactacactcgaagtcttccacca
gtggaacacaactgccctactccgatgggtattaaaggcaaaaaggagcttccagattct
caaatcattgtggagaaatttttgatgaggagaaaatttatacctgaccctcaaggcaca
aatgtgatgttcacattttttgcccaacacttcactcaccagttcttcaaaacagatcac
cgcaaaggaccagagttcacaaaaggccttggacatggggttgatctgagtcacatttat
ggagagactttagacagacagatgaaactgagactacttaaggatggaaaactcaaattt
cagatgatcgatggagaaatgtatccacccacagtgaaagacactcaggcagaaatgatc
tatccaccccatatccctgagcacttgagattttgtgtagggcaagaggtctttggtttg
gttccaggactgatgatgtatgcgacattgtggctacgggaacacaaccgggtgtgtgac
gttcttaaaggggagcacccagaatgggacgatgaacagctgttccaaacaaccaggctg
atcttgataggtgaaaccattaagattgtgattgaagactatgtacagcatttaagtggc
tatcacttcaagctgaagtttgatccagagctgctctttaaccaacgattccagtatcag
aacagaatagcagccgagttcaacaccctctaccactggcatcctcttctgcctgatact
tttaacattcaggaccaagaatatacttatcagcagtttgtctacaacaattccattatg
ctggaccatggcctttctcacatggtacaatctttctccaagcaaatagctggaagggta
gctggaggccggaatgttccagttgcagttctgaaagtggctaaagcttctattgatcaa
agccggcagatgaggtaccaatccctgaatgaatatcgcaaacacttcctcctgaagcct
ttccagtcgtttgaagagcttacaggagagaaagaaatggctgctgaactcaaagagctt
tatggagacatcgatgcgatggagctgtatccagctcttttagtagaaaaaccacgtcct
ggagccatctttggtgagaccatgattgaacttggagcaccgttctccctgaaaggactc
atgggaaatgcaatttgctctcctgagtactggaagccaagcacttttgggggcaaagta
ggctttgacattgtgaacacagcttcgctccaaagacttgtctgcaataacgtggccggc
tgtcctcttacagcattccacgtgttgacccaagaaacaaaggcaacaagcaacaccagc
accaccagtgcatcgttagatgaaatcaatccagcagtactactaaaagagcggtctgca
gaactatag

DBGET integrated database retrieval system