KEGG   Anolis carolinensis (green anole): 100565158Help
Entry
100565158         CDS       T01608                                 

Gene name
pcsk1
Definition
(RefSeq) proprotein convertase subtilisin/kexin type 1
  KO
K01359  proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     100565158 (pcsk1)
Peptidases [BR:acs01002]
 Serine Peptidases
  Family S8: subtilisin family
   100565158 (pcsk1)
Chaperones and folding catalysts [BR:acs03110]
 Intramolecular chaperones
  Subtilisin family
   100565158 (pcsk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein S8_pro-domain Proho_convert Peptidase_S8_N
Motif
Other DBs
NCBI-GeneID: 100565158
NCBI-ProteinID: XP_003216433
Ensembl: ENSACAG00000012731
LinkDB All DBs
Position
2
AA seq 747 aa AA seqDB search
MARRGWAGHPLCVAVALLWAAASPAQAGRQFVNEWAAEIPGGPEAAQAIARELEYELLGQ
IGSLENHYLFRHQSHPRRSRRSAILITKRLSDDHRVSWAEQQYGKKRSKRSVFKGSAENL
FNDPMWNQQWYLQDTRMTQSLPKLDLHVLPVWQKGITGKGVVITVLDDGLEWNHTDIYSN
YDPEASYDFSDNDQDPFPRYDPTNENKHGTRCAGEIAMQANNLKCGVGVAYNSKVGGIRM
LDGIVTDAIEASSIGFSPDHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGIKKGRKGKG
SIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATAYSSGDY
TDQKIISADLHNECTSTHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEFDPL
ANNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPKSWKGIPEKKECIVRDSSFEPRLLK
ASGEVAIEIPTTACEGQENAIKSLEHVQFEATIEYSRRGDLHVTLTSPSGTNTVLLAERQ
RDKSPNGFKDWDFMSVHTWGEDPTGTWSLKIVDLSRRMQNEGRIVNWKLILHGTSTRPEH
MKKPRIYTSYNTVQNDRRGVEKMTDFVEEHTTQENLNEKTKEAEIPSSDGKTKERPFSDA
MIRLLQNAFQSQMASNQVSKKRLNGNSNIPYEHFQQALEKLNRASQLKDSEESLYNDYVD
LFYNSKPYKHRDDRLLQALVDILNDED
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atggccaggcgaggctgggctgggcatcctctctgcgtggcggtggctctgctttgggcg
gcagccagtcctgcccaggcggggaggcagtttgtcaacgagtgggcagccgagatcccc
ggcggccccgaggcggcccaagccatcgcccgcgaactggagtacgagcttctcgggcag
attggatcacttgaaaatcattatctcttcagacatcaaagccacccaagaaggtctcga
agaagcgctattctcatcacaaaaaggctgtcagatgaccatcgagtttcttgggctgaa
cagcagtatgggaaaaaacgaagtaaacgttcagtattcaaaggctcagcagaaaatctt
ttcaatgatccgatgtggaatcaacaatggtatctgcaagacacaagaatgacccagtca
ctgcccaaattggatctccatgttcttccagtgtggcaaaaggggattacaggaaagggg
gttgtcataacagtgcttgatgatggtttggagtggaatcacacagatatttattctaac
tatgatccagaggcaagttatgatttcagtgacaatgatcaggatccctttcctagatat
gatccaacaaatgaaaacaagcatgggacgcgatgtgcaggagagattgccatgcaagca
aacaacttaaaatgtggagttggagttgcatacaattccaaagttggaggcataagaatg
ctggacggaatagtcactgacgccatagaagccagttcaatcggtttcagcccagatcat
gtggacatttatagtgccagctggggtccaaacgatgacgggaaaaccgtagaagggcca
ggtagattggcacagaaggcttttgaatatggaattaaaaaggggcgaaaagggaaaggc
tcaatttttgtctgggcttctgggaatggtggccgacaaggagataactgtgactgcgat
ggctatacagatagcatctacactatctccatcagcagtgcttcacagcaaggcctttcc
ccgtggtacgcagagaagtgttcttcaacactggccacagcgtacagcagcggggattat
actgaccagaaaattataagtgctgaccttcataatgaatgtacctccactcatactggg
acctcagcttctgcacctttagctgcagggatttttgcccttgctcttgaagccaatcct
aatctaacctggagggatatgcaacatttggtagtctggacatctgaattcgatccgttg
gccaacaatccaggatggaagaagaatggggctgggctgatggtgaacagcagatttgga
tttggattactcaatgctaaagcattggtagatttggcagaccctaaaagctggaaaggc
atcccagaaaagaaagagtgcattgtgagggacagcagctttgagccaaggttgctaaaa
gctagtggtgaagttgccattgaaattcccacaacagcttgcgaaggtcaagaaaatgcc
attaagtctctggaacatgtacagtttgaagccacaattgaatattcccgtagaggtgat
cttcatgtgaccctaacttctccatcaggaaccaacacagtcctactggctgaaaggcaa
agggacaaatcgcctaatggttttaaagactgggattttatgtcagttcacacctgggga
gaggatccaacaggaacatggagtttaaaaattgttgatttgtccagaagaatgcaaaat
gaagggcgaattgtgaactggaaattgattttgcatggcacatctacccggcctgagcac
atgaagaaaccccgaatttatacatcatacaacactgtccaaaatgataggagaggagtg
gaaaagatgacagactttgtagaggaacacactacacaggagaacctgaatgaaaaaacc
aaggaggcagaaattcccagcagcgacgggaaaacgaaggagaggcccttttcagatgca
atgatccgtctactgcaaaatgcatttcagagccagatggccagcaatcaagtctcaaag
aagagacttaatggaaactccaacattccctatgaacatttccaacaagctctcgagaaa
ctaaaccgagcctcccagttgaaagactcagaggagtctctgtataatgactacgttgac
cttttctacaattccaaaccatacaaacatagagatgacagactactgcaagccttggtt
gatattttgaatgatgaagattaa

DBGET integrated database retrieval system