KEGG   Anolis carolinensis (green anole): 100567428Help
Entry
100567428         CDS       T01608                                 

Gene name
tgm3
Definition
(RefSeq) transglutaminase 3
  KO
K05620  
transglutaminase 3 [EC:2.3.2.13]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100567428 (tgm3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
Un
AA seq 685 aa AA seqDB search
MTAKIDWKLKDNGIAHRTDRYSGSELAVRRGQPFGVSLTYGGNPPAVSSLTFTVETGSTA
ALQTKTRVAFGVTGSPPNNNWGAVQTAPAPGTMSFSIFSPVNAGIGRYRFGIRTGGSSAP
SSLLGTFVLLFNPWLQGDEVFMPNNAEREEYVLSESGVVFMGSSNSISPRGWDFGQFQPD
ILDICLSILDRSLNHRRDAATDLRRRNDPKYVGRVLSAMVNSNDDNGVVLGNWSGNYSGG
ENPGSWSGSVRILQQWKSSGFRPVRFGQCWVFAGVLTTVLRCFGFPARMISNFNSAHDTD
QSLTVDVYYDPAGNPLNMDSDSIWNFHVWNEAWFARSDLGSTYNGWQILDATPQERSSGI
FQCGPASLVAIKEGDVDLDYDCPFVYAETNADRVTWTYDTATGQKKKIYSETKSVGQFTS
TKAVGSFARKDVTNDYKYPEGSTKERDVFNKARGKLNLSTLEATSRVPDAPKPDVSGKFK
VKSPPEVGKDVELVLLLTNLASAARTLTANMTAWSIVYTGKVIHEVWKDSLALTLGPKEE
KAYPIKISYEEYQKHLTTDNMIRATAVCHFKDGNDAVVEQDIALENPTITLKVPGQAKVG
QAVKVEVVFTNPLAEVVSSCVLLAEGSDLLEKAIRKEVSTVKGKESARITFEITPKKKGT
KQLVTNFSCDKFKDINTFQVIKVVD
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccaagattgactggaagctgaaggacaatggcattgcccaccgcactgaccgg
tacagcgggagtgagttggccgtgcgccgggggcagccctttggcgtctccctgacctac
gggggaaaccccccagcagtgagtagcctcaccttcacagtggaaaccggttcaacggct
gctctccagaccaagacgcgggtggcctttggcgtcactgggtctccacccaacaacaac
tggggcgcggtccagaccgcccctgcccccggcaccatgagcttctccatcttcagccca
gtgaatgcaggcatcgggcggtaccggtttggcatccggaccgggggcagcagcgcccct
tcctccctcctgggcaccttcgtgctcctcttcaacccatggctccaaggcgatgaggtc
ttcatgccaaacaatgcagagcgtgaggagtatgtcctttcagagtccggggtggtcttc
atgggcagctccaacagcatcagtccacgtggatgggactttggtcagtttcagccagac
attctggacatctgcttgtccatcctggaccggagccttaaccaccgcagagatgcagcc
accgacctccgtcgccgcaatgaccccaaatacgttgggcgtgtgctcagcgccatggtc
aacagcaacgacgacaacggcgtggtgttgggcaactggagcggcaattactctggtggg
gagaatcctgggagctggtcaggaagtgtgaggatcctgcaacaatggaagtcctctgga
tttcggccagtccgctttgggcagtgctgggtctttgcaggagtgctgaccacagtgctc
cggtgcttcggtttccccgcccgcatgatctccaacttcaactcagcccatgacacagac
cagagcctgacggtggatgtctactacgatcccgccgggaaccccctcaacatggactct
gacagcatctggaacttccacgtgtggaatgaggcctggttcgcccgctccgacctgggc
tccacgtacaatggctggcaaattttggatgccactccgcaagaacgaagctctggcatc
ttccagtgcggcccagcttccttggtggccatcaaggaaggagacgtggacctggactac
gactgccccttcgtctacgccgagaccaacgcagaccgcgtcacctggacctatgacaca
gccaccgggcaaaagaagaagatctactcggagaccaagtccgtgggccagttcaccagc
accaaggccgtgggcagctttgcccgcaaagacgtcaccaacgactacaagtacccagaa
ggctccaccaaggagcgggatgtcttcaacaaggcccggggcaagctgaacctgagcacg
ctggaagccacctcccgagtgccagatgctcccaagccagacgtgtccgggaagttcaag
gtgaagagcccgcctgaggtcggcaaggacgtggagctggtcctgctgctgaccaacctg
gcctctgcagccaggaccctgacagccaacatgaccgcctggagcatcgtctacaccggg
aaggtcatccatgaggtctggaaggactcccttgccctgacgctgggccccaaagaagag
aaagcctatcccatcaagatctcttatgaggaataccagaagcacctgactacggacaac
atgatccgggcgacggctgtgtgccacttcaaggatgggaacgacgctgtggtggagcaa
gacatcgccttggagaatcccaccatcaccttgaaggtgccgggccaggccaaggtgggc
caagcggtgaaggtggaggtggtcttcaccaacccgctggcagaagtggtctcctcttgt
gtgctcctggccgagggcagcgacctgctggagaaggcgatccggaaggaggtgtcgacc
gtgaagggcaaggagagtgcccgcatcaccttcgaaatcacccccaagaagaagggcacc
aagcagctggtgaccaacttctcctgcgacaaattcaaggacatcaataccttccaggtc
atcaaggtggtcgactga

DBGET integrated database retrieval system