KEGG   Acidithiobacillus caldus SM-1: Atc_0927Help
Entry
Atc_0927          CDS       T01581                                 

Definition
(GenBank) Ribulose bisphosphate carboxylase small chain
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
acu  Acidithiobacillus caldus SM-1
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:acu00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Atc_0927
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Atc_0927
Enzymes [BR:acu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Atc_0927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
923897..924229
Genome map
AA seq 110 aa AA seqDB search
MAEVQEYKQVRRYETFSYLPPFSAEQVRAQIQYIIAQGWNPAVEHIEPNRPFTYYWYMWK
LPMFGERNVDAVLAELEACRREYPNHLIRLIGYDNYTQSQGLSFVVYRGS
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagtgcaagaatacaagcaggtccggcggtatgagaccttttcgtacctgccg
cccttttccgcggagcaggtgcgggcccagatccagtacatcatcgcccagggctggaat
ccggcggtggaacacatcgagcccaaccgtccctttacctactactggtacatgtggaag
ctgccgatgttcggcgagcgcaatgtcgatgccgtcctggcggagttggaggcctgccgg
cgcgagtacccgaaccacctgatccgtctcatcggttacgacaattacacccagagtcag
ggtttgtctttcgtcgtctatcgcggttcctga

DBGET integrated database retrieval system