KEGG   Acidithiobacillus caldus SM-1: Atc_1791Help
Entry
Atc_1791          CDS       T01581                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
acu  Acidithiobacillus caldus SM-1
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:acu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Atc_1791
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Atc_1791
   00680 Methane metabolism
    Atc_1791
Enzymes [BR:acu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Atc_1791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1850741..1853533
Genome map
AA seq 930 aa AA seqDB search
MENKKVPNDRALRARVKRLGNLLGEVLKEQAGDRVFNAVEQLRQGYIRLHRREDPKLRKR
LARFIDALPQDDLVLVIRAFNTYFSLVNIAEEEFQHLQRRRLLQRSEALWVGSFEETFRA
LQQQGIHSGQLQYLLGQIRYLPVFTAHPTESKRRTVLHGLRRIFLTSKMLDDPSLSQEEE
NDVLRQLKAQIQILWETEEVRSNRPQVQDEVENGLFYFRDSLFNAVPMCYHAARRAVRRV
YGNPNVDIPAFIRFGSWIGGDRDGNPNVTAAITGWALRTQSMEVLREYQRRLADLYQLLG
HSSRFCAVSPVLLASLERDADDFPELAEWVNQRFPSEPYRRKLRYMMTRLDLRLRQLENG
QILNEAAGPGYSSASEFLEDLLLVRDSLRGHRDHYIAEHDVQNLVWLLETFGFHLAALDI
RQESTVHGQTIAELFRDVAGFANYLEQPEEQRLLTLAEALRRPGCLVTETPELSPLAAET
CAMFRCIAQLRREVSPEAFGSYVISMTHEASHILEVLLLAKEFGLAGWSREGLYSEIAVT
PLFETIHDLERMEAVMSRLLDDPVYAEILRSQGNLQEVMLGYSDSCKDGGILSSSWSLYQ
AQIRLAELADRRRIQIRVFHGRGGSVGRGGGPTYEAIMAQPPDTVRGQIKITEQGEVLSF
KYANLETAVYELTVGVAGLIRASVGLVRRVELDRPDYLQVMSELVEIGEAVYRDLTEHTP
GFMDYFYEATPLNEIAHMNIGSRPSHRHRGDRSMASIRAIPWVFAWAQSRHVLPAWYGLG
SALARWRGDDPDRLNTLRDMAKHWPFFRALLGNISMAMAKTHLDLAREYAGLPQDQECAQ
KIFAKIRAEYELSLAELLTALDLPAPLADNPTLAFSLQRRNVYMEPLNHIQLALLRRYRN
EDTPQEFRETWLDPLLRTINAIAAGQRNTG
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaacaaaaaggtacccaacgatcgggccctgcgggcgcgagtcaagcgtctcggc
aacctgctcggggaggtgctcaaggagcaggcaggtgaccgcgtcttcaacgcggtggag
cagttgcgccagggctatatccgcctgcaccgccgggaagaccccaagctacgcaagcgt
ctggcccgcttcatagacgccttgccccaggacgacctggtcctggtcattcgcgccttc
aatacctatttcagcctcgtcaacattgccgaagaggagtttcagcacctgcagcgccgc
cgcctcctccaacgcagtgaggcactctgggtgggctccttcgaagagaccttccgcgcc
ttgcagcagcagggcatccactccggccagttgcagtatctgctgggtcagatccgttac
cttccggttttcaccgcccaccccacggagtccaaacggcgtacggtgctccacggcctg
cgccgcatcttcctcaccagcaagatgctggatgacccaagcctgtcccaggaagaggaa
aacgacgttctccgtcaactgaaggcgcagatccagattctctgggaaacggaagaggtg
cgcagcaaccgaccgcaggtacaggacgaggtggaaaacggccttttctactttcgcgac
agcctcttcaatgccgtgcccatgtgctatcacgctgcgcgccgtgcagtgcgccgggtc
tacggcaaccccaacgtggatattcccgccttcatccgctttggctcctggattggtggc
gaccgcgacggcaatcccaatgtgacggcagccatcaccggctgggcgctgcgtacccag
agcatggaggtactgcgggaatatcagcggcgtctggccgacctctatcaactcctgggc
cattccagccgtttctgcgccgtatcccccgtgctgctggcctcgctggaacgcgacgcc
gacgattttccagaactcgccgagtgggtcaatcagcgttttcccagcgaaccctaccgg
cgcaaactccgctacatgatgacccgtctggatctgcgcctgcgccagctggaaaacggt
cagattctcaacgaggcagccggacccggctacagcagtgcgagcgagttcctcgaggat
ctgctgctggtgcgcgactctctgcgcgggcaccgcgaccactacattgccgaacacgat
gtccagaatctggtctggttgctggaaaccttcggcttccatctggcagcactggatatt
cgccaggaatcgacggtccatggccaaaccattgcggaactctttcgcgacgtagcgggc
tttgccaactacctggaacagccagaggagcagcgtctgctcaccttggccgaggccctg
cgccgtcccggttgtctggtcacggagacgccggagctgagccctctggccgcggaaacc
tgtgcgatgtttcgttgcattgcccagctgcgccgagaggtcagtccagaggccttcggc
agctacgtcatctccatgacccacgaggccagtcacatcctcgaggtgctcctcctggcc
aaggagtttggcctggccggctggtcgcgcgaagggctgtacagcgaaatcgccgtaacc
cccctcttcgagaccattcacgacctcgagcgcatggaggcggtcatgagccggctcctg
gacgacccggtctacgccgaaatcctccgcagtcaggggaacctccaggaagtaatgctc
ggctactccgactcctgcaaggacggtggcatcctctcttccagttggtccctgtatcag
gcgcagattcgcctggcggagcttgccgatcgccgccgcatccagatccgcgtgtttcac
ggccggggcggcagcgtcggtcgcgggggcgggcccacctacgaggccatcatggcccag
cctccggataccgttcgcggccagatcaagatcaccgagcagggtgaggtgctgtccttc
aagtacgccaacctggagacggcggtctacgagctgaccgtgggggttgccggcctcatc
cgtgccagcgtcgggctggtccgccgggttgagctggatcgaccagactacctgcaggtc
atgagcgagctcgtggagatcggcgaggccgtctatcgcgatctgacggagcacaccccg
ggcttcatggactacttctacgaggccacgcccctcaacgaaatcgcccacatgaacatc
ggttcccggccttcccatcgccaccgtggcgatcgctccatggcctccatccgcgccatt
ccctgggtctttgcctgggcccagtcgcgacacgttctgcccgcctggtatggcctgggt
tccgccctggcgcgttggcgcggcgatgaccccgaccgccttaatacgctccgcgacatg
gcaaaacactggccattttttcgcgcactgctgggcaatatctccatggccatggccaag
acccatctcgacctggcccgggaatacgccggtctgccccaggatcaagaatgcgcccag
aagatcttcgccaagatccgcgcggaatacgagctcagtctggcggagctgctgactgcc
ctggacctcccggcccccctggccgacaaccccaccctcgccttctccctgcagcgccgc
aatgtctatatggagcccctcaaccacatccagttggccctgctgcgccgctaccgcaat
gaggataccccccaggaattccgcgagacctggctcgatcccctcctgcgcaccatcaac
gccattgccgccggccaacgcaacaccggttga

DBGET integrated database retrieval system