KEGG   Azotobacter chroococcum: Achr_23950Help
Entry
Achr_23950        CDS       T03640                                 

Definition
(GenBank) Glutathione S-transferase protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
acx  Azotobacter chroococcum
Pathway
acx00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:acx00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Achr_23950
Enzymes [BR:acx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Achr_23950
Transporters [BR:acx02000]
 Other Transporters
  Pores ion channels [TC:1]
   Achr_23950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_N_2 GST_N GST_N_3 GST_C_2 Glutaredoxin2_C DUF1958
Motif
Other DBs
NCBI-ProteinID: AJE21832
UniProt: A0A0C4WTW5
LinkDB All DBs
Position
complement(2681935..2682540)
Genome map
AA seq 201 aa AA seqDB search
MKLYYTPGACSLVPHIVLCELGLPYELEKVDLKSHTIEGGGDYYNVNPKGYVPTLQLNDG
QRLTESGAIALFLAEKLPEAGLLPGNGSLERFRVQEWLFFIGSELHKEIGQLFNPQITSE
WKKAALAAVEQRLAYVDKVLTGQDYLNGARFSVADAYLFTVLSWTKPLDIDLSPWPALRA
FHDRVAARPAVQKAMQAEGLL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctactacacccccggggcctgctccctggttccgcacatcgttctttgcgaa
ctgggcctgccctacgaactggagaaggtggatctgaagagccataccatcgagggtggt
ggggattactacaacgtcaatcccaagggctatgtaccgaccctgcagctgaacgacggc
cagcggctcaccgagagcggggccattgccctgttcctcgccgagaagctgcccgaggcc
ggtctgctgccgggcaacggcagcctggagcgcttccgcgtccaggagtggctgttcttc
atcggcagcgaactgcacaaggagatcggccagctgttcaatccgcagatcacctccgag
tggaagaaggccgcgctggccgccgtcgagcagcgcctggcctatgtcgacaaggtgctc
accggacaggactacctgaacggcgcgcgcttctccgtggcggatgcctatctgttcacc
gtgctgagctggaccaagccgctggacatcgatctttccccctggccggccctgcgcgcc
ttccacgaccgggtggcggcgcggcccgccgtgcagaaggcgatgcaggcggaagggctg
ctctag

DBGET integrated database retrieval system