KEGG   Anabaena cylindrica: Anacy_0961Help
Entry
Anacy_0961        CDS       T02435                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase, type 1
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
acy  Anabaena cylindrica
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:acy00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Anacy_0961
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Anacy_0961
   00680 Methane metabolism
    Anacy_0961
Enzymes [BR:acy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Anacy_0961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1138999..1142025
Genome map
AA seq 1008 aa AA seqDB search
MGSLLYSSSPAANTYPMSELFLRHRLQVVEELWESVLRQECGQKMVDLLRQLRDLCSPEG
QATHDQASSAVELIEQLNINEAIRAARAFALYFQLINIIEQEYEQKQQLTRYSDTNGTDQ
VNLANIIYSTNQREDDLPVTKSLGSDSPQSWTDTTPIQQKGTFAALFPLLFKLNVPPQQI
QRLISQLDIRLVFTAHPTEIVRHTIRDKQRQVVDLLQHLDSLENRSGGYPWEAAEVRERL
MEEIRLWWRTDELHQFKPTVLDEVDYALHYFQEVLFDGIPQLYKRLKYSLAQTFPWLEPP
STNFCSFGSWVGSDRDGNPSVTPEVTWKTACYQRKMVLERYIQSVTQLIELLSVSMHWSD
VLPDLLESLELDQSTMSDVYDALALRYRQEPYRLKLAYVLRRLENTRDRNLALYKRETPT
NEDAPMYRSGAEFLAELRLIHHNLTETGLGCRALETLICQVEIFDFNLTQLDIRQESSRH
ADALNEILEYLQVLPQPYNELSEEQKVAWLTGELRTRRPLIPSELPFSEKTNDVIETFRV
LRSLQQEFGINICQTYIISMCREVSDVLEVLLLAKEARLFDPAIAVGSIRVVPLFETVED
LQRSRSVMRQLFELPLYRAFLAGGYEAIKPENSSPSPTLNPNLQEVMLGYSDSNKDSGFL
SSNWEIHKAQKSLQKIAEEYGLHLRIFHGRGGSVGRGGGPAYEAILAQPGHSINGRIKIT
EQGEVLASKYSLLDLALYHVETITSAVIQASLLRTGFDDIEPWNEIMEELSMRSRQHYRA
LIYEQPDFIDFFHQVTPIEEISQLQISSRPARRPSGKKDLSSLRAIPWVFSWTQTRFLLP
SWYGIGTALQEFLNAEPEEHLKLLRYFYVKWPFFKMVISKAEMTLAKVDIEMARHYVDEL
SSPEDKPRFDKVFEQIASEFYLTRNLVLNITGHQRLLDGDPTLQRSVQLRNGTIVPLGFI
QVSLLKRLRQYKNTSTSGIIHSRYSKGELLRGALLTINGIAAGMRNTG
NT seq 3027 nt NT seq  +upstreamnt  +downstreamnt
atgggttcccttttatactcttcatcgccagcagcgaatacataccccatgtcggaatta
ttcttgcgtcatcgtctacaggtagtagaggaattgtgggagtcggttcttcggcaagaa
tgcggacaaaaaatggtagatctattgcgtcaattgcgcgatttgtgttctcctgaagga
caagctacccatgaccaggcttcctccgcagtcgaattgattgaacaattaaatatcaac
gaggccattcgtgctgctcgtgcctttgctctgtattttcagttaattaacatcattgag
caggaatacgaacaaaagcagcaacttactcgctattctgatacaaacggtacagatcag
gtaaatctcgccaatattatttattcaaccaaccaacgagaagatgacctaccagttacc
aagtcattaggatcagactcaccacaaagttggacagacaccacgccaattcaacaaaag
ggtacatttgccgctttatttccgctgttattcaaactgaatgttccaccccagcaaatt
caacgcctcatttctcaactggatatccgcttagtcttcactgcacaccccacggaaatt
gtccgtcatactatccgcgataaacagcggcaggtagttgaccttttacaacacctagat
agcttagaaaatcgctctgggggctatccttgggaggcagccgaggtgagagagcgattg
atggaagaaattcgtctgtggtggcggacagatgagctacatcaatttaagcccacggtt
ttagatgaggtagattatgctctgcactacttccaagaagtgttatttgatggcattccg
cagttgtataaacgcctcaaatattctctagcacaaacatttccttggctagaaccacca
agtacaaatttctgctcctttggttcttgggtaggttcagaccgagatggaaatccgtcg
gtgacaccggaagttacttggaagactgcttgttatcagcggaaaatggtcttagagcga
tatattcagtcggtgacgcaactgattgagttattgagtgtgtccatgcactggagtgat
gtattaccagatttgctggaatctctagagttagatcaatcaacgatgagtgatgtctat
gatgctttagctctgcgttatcgccaagaaccttatcggttaaaactggcttatgtgttg
agacggctagaaaatacacgcgatcgcaatttggctttatataaacgggaaacgcccaca
aatgaagatgcaccaatgtaccgttccggggcagagtttttagctgaattgcgattaatt
caccacaatttgactgaaacgggtttaggctgtcgagctttagaaaccctaatttgtcaa
gtggaaatttttgactttaacctcacccagctagatattcgccaagaatcatcccgtcat
gctgatgcgctgaatgagattcttgaatacttgcaagttttaccccaaccctataacgaa
ctttcagaagagcagaaagtggcttggttaaccggggaattacgaacaagacggccatta
attcccagtgaattgccattttcggaaaaaaccaacgatgtcattgaaactttccgggtt
ttgcgatcgctacaacaagaatttggcatcaacatctgtcagacttacatcatcagtatg
tgccgcgaagtcagcgatgttttagaagttttactcttagccaaagaagcgagattattt
gatcctgcgatcgcagtaggatcaattagagtagtaccgctatttgagactgtagaagac
ttacaacgctccagaagcgtcatgcggcaactgtttgaacttcccctttatcgcgccttc
ttagcaggtggctatgaagcaattaaacccgaaaattcttctccatctcccaccctcaac
cccaatttgcaagaagtcatgctggggtattctgacagcaacaaagactccggtttctta
agtagcaactgggaaattcacaaagcgcaaaaatcactccagaaaatcgctgaagaatac
ggcttacatctgcggatttttcacggtagaggtggatctgtgggacggggtggtggccca
gcttatgaggcgattttagctcaaccaggtcacagtatcaacggccgcattaagattacc
gaacaaggagaagttttagcttctaaatattccttgttggatttggctttgtaccacgta
gaaaccattaccagtgcggttattcaagctagtttactgcggactggatttgatgatatt
gaaccatggaatgagatcatggaagagttgtcaatgcgatcgcgtcagcattatcgcgcc
ctcatttacgaacaacctgattttattgacttcttccaccaagtcacccccattgaagaa
atcagccaactgcaaattagctcccgtccagcgcgaagaccatctggtaaaaaagactta
agcagcttacgagccattccttgggtatttagttggacacaaaccagatttttgttacct
tcttggtacggtatcggcacagccttacaagaatttttaaacgccgaaccagaagaacac
ctcaaattgctacgctacttttatgtcaaatggcctttcttcaaaatggtaatttccaaa
gccgaaatgaccttagccaaagtagatattgaaatggcacgtcattacgttgatgaatta
tccagcccagaagacaaaccccggtttgacaaagtatttgagcaaattgccagcgaattt
tatctcaccagaaatttagtcttaaacatcaccggacaccagcgacttttagatggtgat
ccaactttacagcgttcagtacagttaagaaatgggacaattgtacctttaggatttatc
caagtttctctactcaagcgtctacggcagtacaaaaacaccagcacctctggaataatt
cactcccgttacagcaaaggtgagttactcagaggagcattgttaaccattaacggtatt
gctgcgggaatgagaaatacaggctga

DBGET integrated database retrieval system